Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7838
Gene name
LocationContig_48:13630..14618
Strand-
Gene length (bp)988
Transcript length (bp)816
Coding sequence length (bp)816
Protein length (aa) 272

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00227 Proteasome Proteasome subunit 1.0E-45 27 207
PF12465 Pr_beta_C Proteasome beta subunits C terminal 1.6E-11 221 255

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09841|PSB2_SCHPO Probable proteasome subunit beta type-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pup1 PE=2 SV=1 3 270 9.0E-114
sp|P25043|PSB2_YEAST Proteasome subunit beta type-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUP1 PE=1 SV=1 1 251 2.0E-113
sp|P70195|PSB7_MOUSE Proteasome subunit beta type-7 OS=Mus musculus GN=Psmb7 PE=1 SV=1 3 245 2.0E-104
sp|Q99436|PSB7_HUMAN Proteasome subunit beta type-7 OS=Homo sapiens GN=PSMB7 PE=1 SV=1 3 245 9.0E-104
sp|Q9JHW0|PSB7_RAT Proteasome subunit beta type-7 OS=Rattus norvegicus GN=Psmb7 PE=1 SV=1 3 245 3.0E-103
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09841|PSB2_SCHPO Probable proteasome subunit beta type-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pup1 PE=2 SV=1 3 270 9.0E-114
sp|P25043|PSB2_YEAST Proteasome subunit beta type-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUP1 PE=1 SV=1 1 251 2.0E-113
sp|P70195|PSB7_MOUSE Proteasome subunit beta type-7 OS=Mus musculus GN=Psmb7 PE=1 SV=1 3 245 2.0E-104
sp|Q99436|PSB7_HUMAN Proteasome subunit beta type-7 OS=Homo sapiens GN=PSMB7 PE=1 SV=1 3 245 9.0E-104
sp|Q9JHW0|PSB7_RAT Proteasome subunit beta type-7 OS=Rattus norvegicus GN=Psmb7 PE=1 SV=1 3 245 3.0E-103
sp|A1XQU1|PSB7_PIG Proteasome subunit beta type-7 OS=Sus scrofa GN=PSMB7 PE=2 SV=2 3 245 1.0E-102
sp|Q2TBP0|PSB7_BOVIN Proteasome subunit beta type-7 OS=Bos taurus GN=PSMB7 PE=1 SV=1 3 245 4.0E-102
sp|Q7DLS1|PSB7B_ARATH Proteasome subunit beta type-7-B OS=Arabidopsis thaliana GN=PBB2 PE=1 SV=2 3 251 1.0E-95
sp|O23710|PSB7A_ARATH Proteasome subunit beta type-7-A OS=Arabidopsis thaliana GN=PBB1 PE=1 SV=2 3 251 3.0E-95
sp|Q54QR2|PSB7_DICDI Proteasome subunit beta type-7 OS=Dictyostelium discoideum GN=psmB7 PE=3 SV=1 3 245 2.0E-90
sp|P40306|PSB10_HUMAN Proteasome subunit beta type-10 OS=Homo sapiens GN=PSMB10 PE=1 SV=1 3 245 6.0E-81
sp|O35955|PSB10_MOUSE Proteasome subunit beta type-10 OS=Mus musculus GN=Psmb10 PE=1 SV=1 3 245 3.0E-80
sp|Q3T0T1|PSB10_BOVIN Proteasome subunit beta type-10 OS=Bos taurus GN=PSMB10 PE=1 SV=1 3 246 6.0E-80
sp|Q4KM35|PSB10_RAT Proteasome subunit beta type-10 OS=Rattus norvegicus GN=Psmb10 PE=2 SV=1 3 245 3.0E-78
sp|Q8SQN7|PSB2_ENCCU Probable proteasome subunit beta type-2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=PUP1 PE=1 SV=1 26 247 4.0E-56
sp|A2SS78|PSB_METLZ Proteasome subunit beta OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=psmB PE=3 SV=1 28 211 2.0E-28
sp|Q9DD33|PSB9_SALSA Proteasome subunit beta type-9 OS=Salmo salar GN=psmb9-a PE=2 SV=1 22 223 4.0E-27
sp|Q3MHN0|PSB6_BOVIN Proteasome subunit beta type-6 OS=Bos taurus GN=PSMB6 PE=1 SV=1 24 207 8.0E-27
sp|Q9PT26|PSB9_ONCMY Proteasome subunit beta type-9 OS=Oncorhynchus mykiss GN=psmb9 PE=2 SV=1 22 223 9.0E-27
sp|A3CUS9|PSB_METMJ Proteasome subunit beta OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=psmB PE=3 SV=1 29 211 9.0E-27
sp|P28073|PSB6_RAT Proteasome subunit beta type-6 OS=Rattus norvegicus GN=Psmb6 PE=1 SV=3 24 207 5.0E-26
sp|A7I841|PSB_METB6 Proteasome subunit beta OS=Methanoregula boonei (strain 6A8) GN=psmB PE=3 SV=1 24 211 1.0E-25
sp|B8GG66|PSB_METPE Proteasome subunit beta OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=psmB PE=3 SV=1 26 210 2.0E-25
sp|Q60692|PSB6_MOUSE Proteasome subunit beta type-6 OS=Mus musculus GN=Psmb6 PE=1 SV=3 24 207 2.0E-25
sp|P28072|PSB6_HUMAN Proteasome subunit beta type-6 OS=Homo sapiens GN=PSMB6 PE=1 SV=4 24 207 2.0E-25
sp|B1L6S7|PSB1_KORCO Proteasome subunit beta 1 OS=Korarchaeum cryptofilum (strain OPF8) GN=psmB1 PE=3 SV=1 29 207 1.0E-24
sp|Q2FQL8|PSB_METHJ Proteasome subunit beta OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=psmB PE=3 SV=1 26 210 3.0E-24
sp|D4GYZ1|PSB_HALVD Proteasome subunit beta OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=psmB PE=1 SV=1 5 218 3.0E-24
sp|O43063|PSB1_SCHPO Probable proteasome subunit beta type-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pre3 PE=3 SV=1 29 210 8.0E-24
sp|D3RX66|PSB_FERPA Proteasome subunit beta OS=Ferroglobus placidus (strain DSM 10642 / AEDII12DO) GN=psmB PE=3 SV=1 29 208 9.0E-24
sp|Q9P996|PSB_ARCFU Proteasome subunit beta OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=psmB PE=1 SV=1 29 211 1.0E-23
sp|Q55GJ6|PSB6_DICDI Proteasome subunit beta type-6 OS=Dictyostelium discoideum GN=psmB6 PE=1 SV=1 22 222 2.0E-23
sp|A1RWY6|PSB1_THEPD Proteasome subunit beta 1 OS=Thermofilum pendens (strain Hrk 5) GN=psmB1 PE=3 SV=1 29 216 2.0E-23
sp|D2RGT4|PSB_ARCPA Proteasome subunit beta OS=Archaeoglobus profundus (strain DSM 5631 / JCM 9629 / NBRC 100127 / Av18) GN=psmB PE=3 SV=1 29 210 5.0E-23
sp|A1RX71|PSB2_THEPD Proteasome subunit beta 2 OS=Thermofilum pendens (strain Hrk 5) GN=psmB2 PE=3 SV=1 29 207 8.0E-23
sp|B9LTS6|PSB_HALLT Proteasome subunit beta OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=psmB PE=3 SV=1 5 216 9.0E-23
sp|Q8UW64|PSB9_ORYLA Proteasome subunit beta type-9 OS=Oryzias latipes GN=psmb9 PE=3 SV=1 22 223 1.0E-22
sp|Q9YER0|PSB2_AERPE Proteasome subunit beta 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=psmB2 PE=3 SV=2 24 207 1.0E-22
sp|P28065|PSB9_HUMAN Proteasome subunit beta type-9 OS=Homo sapiens GN=PSMB9 PE=1 SV=2 22 209 4.0E-22
sp|Q3SZC2|PSB9_BOVIN Proteasome subunit beta type-9 OS=Bos taurus GN=PSMB9 PE=1 SV=1 22 209 7.0E-22
sp|Q975D1|PSB2_SULTO Proteasome subunit beta 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=psmB2 PE=3 SV=1 24 210 1.0E-21
sp|P38624|PSB1_YEAST Proteasome subunit beta type-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE3 PE=1 SV=2 27 223 1.0E-21
sp|Q8LD27|PSB6_ARATH Proteasome subunit beta type-6 OS=Arabidopsis thaliana GN=PBA1 PE=1 SV=2 27 224 3.0E-21
sp|Q2NI68|PSB_METST Proteasome subunit beta OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=psmB PE=3 SV=1 29 210 3.0E-21
sp|Q8U125|PSB2_PYRFU Proteasome subunit beta 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=psmB2 PE=3 SV=1 24 210 4.0E-21
sp|A9A2U7|PSB2_NITMS Proteasome subunit beta 2 OS=Nitrosopumilus maritimus (strain SCM1) GN=psmB2 PE=3 SV=1 29 215 4.0E-21
sp|Q9V0N9|PSB2_PYRAB Proteasome subunit beta 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=psmB2 PE=3 SV=1 29 210 5.0E-21
sp|Q18GX3|PSB_HALWD Proteasome subunit beta OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=psmB PE=3 SV=1 26 210 6.0E-21
sp|O24361|PSB5_SPIOL Proteasome subunit beta type-5 OS=Spinacia oleracea PE=2 SV=1 2 210 7.0E-21
sp|A4YIE0|PSB1_METS5 Proteasome subunit beta 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=psmB1 PE=3 SV=1 29 226 9.0E-21
sp|A0RXV1|PSB2_CENSY Proteasome subunit beta 2 OS=Cenarchaeum symbiosum (strain A) GN=psmB2 PE=3 SV=2 29 215 1.0E-20
sp|A3DN27|PSB2_STAMF Proteasome subunit beta 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=psmB2 PE=3 SV=1 24 207 2.0E-20
sp|A4FYA5|PSB_METM5 Proteasome subunit beta OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=psmB PE=3 SV=1 29 214 2.0E-20
sp|A3DN21|PSB1_STAMF Proteasome subunit beta 1 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=psmB1 PE=3 SV=1 31 220 2.0E-20
sp|O50110|PSB2_PYRHO Proteasome subunit beta 2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=psmB2 PE=3 SV=1 29 210 4.0E-20
sp|Q58634|PSB_METJA Proteasome subunit beta OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=psmB PE=1 SV=1 29 217 5.0E-20
sp|D3S8M7|PSB_METSF Proteasome subunit beta OS=Methanocaldococcus sp. (strain FS406-22) GN=psmB PE=3 SV=1 29 217 5.0E-20
sp|C7P6N4|PSB_METFA Proteasome subunit beta OS=Methanocaldococcus fervens (strain DSM 4213 / JCM 157852 / AG86) GN=psmB PE=3 SV=1 29 217 6.0E-20
sp|A6VK02|PSB_METM7 Proteasome subunit beta OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=psmB PE=3 SV=1 29 210 7.0E-20
sp|A9A788|PSB_METM6 Proteasome subunit beta OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=psmB PE=3 SV=1 29 210 7.0E-20
sp|O23717|PSB5A_ARATH Proteasome subunit beta type-5-A OS=Arabidopsis thaliana GN=PBE1 PE=1 SV=1 1 204 1.0E-19
sp|Q9P992|PSB_METTE Proteasome subunit beta OS=Methanosarcina thermophila GN=psmB PE=3 SV=1 29 210 1.0E-19
sp|P30655|PSB5_SCHPO Probable proteasome subunit beta type-5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pts1 PE=3 SV=3 29 218 2.0E-19
sp|Q74MP5|PSB_NANEQ Proteasome subunit beta OS=Nanoarchaeum equitans (strain Kin4-M) GN=psmB PE=3 SV=1 30 208 2.0E-19
sp|Q8TW10|PSB_METKA Proteasome subunit beta OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=psmB PE=3 SV=1 27 230 2.0E-19
sp|A3MS44|PSB1_PYRCJ Proteasome subunit beta 1 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=psmB1 PE=3 SV=1 30 208 3.0E-19
sp|Q9LIP2|PSB5B_ARATH Proteasome subunit beta type-5-B OS=Arabidopsis thaliana GN=PBE2 PE=1 SV=1 2 204 4.0E-19
sp|A7KII6|PB6LB_SALSA Proteasome subunit beta type-6-B like protein OS=Salmo salar GN=psmb6l-b PE=3 SV=1 24 229 4.0E-19
sp|A4WH05|PSB1_PYRAR Proteasome subunit beta 1 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=psmB1 PE=3 SV=1 30 208 4.0E-19
sp|Q6LZD4|PSB_METMP Proteasome subunit beta OS=Methanococcus maripaludis (strain S2 / LL) GN=psmB PE=3 SV=1 29 214 4.0E-19
sp|A2BN27|PSB2_HYPBU Proteasome subunit beta 2 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=psmB2 PE=3 SV=1 29 210 5.0E-19
sp|C9REN7|PSB_METVM Proteasome subunit beta OS=Methanocaldococcus vulcanius (strain ATCC 700851 / DSM 12094 / M7) GN=psmB PE=3 SV=1 26 217 5.0E-19
sp|A7KE01|PB6LA_SALSA Proteasome subunit beta type-6-A like protein OS=Salmo salar GN=psmb6l-a PE=3 SV=1 24 229 6.0E-19
sp|A6USJ3|PSB_METVS Proteasome subunit beta OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=psmB PE=3 SV=1 29 212 6.0E-19
sp|P93395|PSB6_TOBAC Proteasome subunit beta type-6 OS=Nicotiana tabacum PE=2 SV=1 27 218 7.0E-19
sp|A9A4A1|PSB1_NITMS Proteasome subunit beta 1 OS=Nitrosopumilus maritimus (strain SCM1) GN=psmB1 PE=3 SV=1 29 212 8.0E-19
sp|P28075|PSB5_RAT Proteasome subunit beta type-5 OS=Rattus norvegicus GN=Psmb5 PE=1 SV=3 29 210 9.0E-19
sp|A6UT20|PSB_META3 Proteasome subunit beta OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=psmB PE=3 SV=1 24 207 1.0E-18
sp|B8D683|PSB2_DESK1 Proteasome subunit beta 2 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=psmB2 PE=3 SV=1 30 207 1.0E-18
sp|Q9YES4|PSB1_AERPE Proteasome subunit beta 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=psmB1 PE=3 SV=2 29 207 1.0E-18
sp|D5EAS6|PSB_METMS Proteasome subunit beta OS=Methanohalophilus mahii (strain ATCC 35705 / DSM 5219 / SLP) GN=psmB PE=3 SV=1 29 210 1.0E-18
sp|Q46G14|PSB_METBF Proteasome subunit beta OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=psmB PE=3 SV=1 29 235 2.0E-18
sp|A8AB58|PSB2_IGNH4 Proteasome subunit beta 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=psmB2 PE=3 SV=1 29 218 2.0E-18
sp|P28077|PSB9_RAT Proteasome subunit beta type-9 OS=Rattus norvegicus GN=Psmb9 PE=1 SV=2 28 210 2.0E-18
sp|Q980L4|PSB1_SULSO Proteasome subunit beta 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=psmB1 PE=3 SV=1 31 207 4.0E-18
sp|D0KRX1|PSB1_SULS9 Proteasome subunit beta 1 OS=Sulfolobus solfataricus (strain 98/2) GN=psmB1 PE=3 SV=1 31 207 4.0E-18
sp|Q12YV7|PSB_METBU Proteasome subunit beta OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=psmB PE=3 SV=1 29 211 5.0E-18
sp|Q8ZYF2|PSB1_PYRAE Proteasome subunit beta 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=psmB1 PE=3 SV=1 30 208 5.0E-18
sp|C3N7K2|PSB2_SULIY Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=psmB2 PE=3 SV=1 31 207 5.0E-18
sp|C3MY41|PSB2_SULIM Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=psmB2 PE=3 SV=1 31 207 5.0E-18
sp|C3MRE5|PSB2_SULIL Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=psmB2 PE=3 SV=1 31 207 5.0E-18
sp|C4KIR0|PSB2_SULIK Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=psmB2 PE=3 SV=1 31 207 5.0E-18
sp|D2PDG6|PSB2_SULID Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain L.D.8.5 / Lassen #2) GN=psmB2 PE=3 SV=1 31 207 5.0E-18
sp|C3MZI0|PSB2_SULIA Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.16.27) GN=psmB2 PE=3 SV=1 31 207 5.0E-18
sp|C3NFX2|PSB1_SULIN Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=psmB1 PE=3 SV=1 31 207 5.0E-18
sp|P28061|PSB_THEAC Proteasome subunit beta OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=psmB PE=1 SV=1 22 208 6.0E-18
sp|Q8TJB5|PSB_METAC Proteasome subunit beta OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=psmB PE=3 SV=1 29 210 8.0E-18
sp|D1Z199|PSB_METPS Proteasome subunit beta OS=Methanocella paludicola (strain DSM 17711 / JCM 13418 / NBRC 101707 / SANAE) GN=psmB PE=3 SV=1 29 214 8.0E-18
sp|Q5R8S2|PSB5_PONAB Proteasome subunit beta type-5 OS=Pongo abelii GN=PSMB5 PE=2 SV=3 29 210 1.0E-17
sp|P28074|PSB5_HUMAN Proteasome subunit beta type-5 OS=Homo sapiens GN=PSMB5 PE=1 SV=3 29 210 1.0E-17
sp|C3NE98|PSB1_SULIY Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=psmB1 PE=3 SV=1 29 207 1.0E-17
sp|C3MVD5|PSB1_SULIM Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=psmB1 PE=3 SV=1 29 207 1.0E-17
sp|C3MQ16|PSB1_SULIL Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=psmB1 PE=3 SV=1 29 207 1.0E-17
sp|C4KHB0|PSB1_SULIK Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=psmB1 PE=3 SV=1 29 207 1.0E-17
sp|D2PK63|PSB1_SULID Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain L.D.8.5 / Lassen #2) GN=psmB1 PE=3 SV=1 29 207 1.0E-17
sp|C3N5N4|PSB1_SULIA Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.16.27) GN=psmB1 PE=3 SV=1 29 207 1.0E-17
sp|A4WMZ0|PSB2_PYRAR Proteasome subunit beta 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=psmB2 PE=3 SV=1 22 207 1.0E-17
sp|Q97AZ7|PSB_THEVO Proteasome subunit beta OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=psmB PE=3 SV=1 22 208 1.0E-17
sp|Q9UXF3|PSB2_SULSO Proteasome subunit beta 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=psmB2 PE=3 SV=2 20 207 2.0E-17
sp|B5IEE5|PSB_ACIB4 Proteasome subunit beta OS=Aciduliprofundum boonei (strain DSM 19572 / T469) GN=psmB PE=3 SV=1 40 229 2.0E-17
sp|A0B5B1|PSB_METTP Proteasome subunit beta OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=psmB PE=3 SV=1 29 211 2.0E-17
sp|D0KTH0|PSB2_SULS9 Proteasome subunit beta 2 OS=Sulfolobus solfataricus (strain 98/2) GN=psmB2 PE=3 SV=2 20 207 2.0E-17
sp|B1L6X8|PSB2_KORCO Proteasome subunit beta 2 OS=Korarchaeum cryptofilum (strain OPF8) GN=psmB2 PE=3 SV=1 31 214 2.0E-17
sp|P30656|PSB5_YEAST Proteasome subunit beta type-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE2 PE=1 SV=3 29 210 2.0E-17
sp|D3E0A3|PSB_METRM Proteasome subunit beta OS=Methanobrevibacter ruminantium (strain ATCC 35063 / DSM 1093 / JCM 13430 / OCM 146 / M1) GN=psmB PE=3 SV=1 24 210 2.0E-17
sp|C3NHF1|PSB2_SULIN Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=psmB2 PE=3 SV=1 29 207 2.0E-17
sp|Q32KL2|PSB5_BOVIN Proteasome subunit beta type-5 OS=Bos taurus GN=PSMB5 PE=1 SV=1 29 210 2.0E-17
sp|C5A7L1|PSB1_THEGJ Proteasome subunit beta 1 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=psmB1 PE=3 SV=1 29 210 3.0E-17
sp|Q8PZ04|PSB_METMA Proteasome subunit beta OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=psmB PE=3 SV=1 29 210 3.0E-17
sp|Q8SR11|PSB1_ENCCU Probable proteasome subunit beta type-1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=PRE3 PE=1 SV=1 28 224 4.0E-17
sp|Q54BC8|PSB5_DICDI Proteasome subunit beta type-5 OS=Dictyostelium discoideum GN=psmB5 PE=1 SV=1 23 210 5.0E-17
sp|A8M8R5|PSB2_CALMQ Proteasome subunit beta 2 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=psmB2 PE=3 SV=1 28 210 5.0E-17
sp|O55234|PSB5_MOUSE Proteasome subunit beta type-5 OS=Mus musculus GN=Psmb5 PE=1 SV=3 29 210 6.0E-17
sp|O35523|PSB9_MUSPL Proteasome subunit beta type-9 OS=Mus platythrix GN=Psmb9 PE=1 SV=1 24 208 6.0E-17
sp|O35522|PSB9_MUSMB Proteasome subunit beta type-9 OS=Mus musculus bactrianus GN=Psmb9 PE=1 SV=1 28 209 7.0E-17
sp|O35521|PSB9_MUSTR Proteasome subunit beta type-9 OS=Mus terricolor GN=Psmb9 PE=1 SV=1 28 209 8.0E-17
sp|O35524|PSB9_MUSSI Proteasome subunit beta type-9 OS=Mus spicilegus GN=Psmb9 PE=1 SV=1 28 209 9.0E-17
sp|P28076|PSB9_MOUSE Proteasome subunit beta type-9 OS=Mus musculus GN=Psmb9 PE=1 SV=1 28 209 1.0E-16
sp|Q8ZST5|PSB2_PYRAE Proteasome subunit beta 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=psmB2 PE=3 SV=1 26 207 1.0E-16
sp|A1RTI7|PSB2_PYRIL Proteasome subunit beta 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=psmB2 PE=3 SV=1 30 210 1.0E-16
sp|B1YA36|PSB1_PYRNV Proteasome subunit beta 1 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=psmB1 PE=3 SV=1 30 208 2.0E-16
sp|Q0W2D6|PSB_METAR Proteasome subunit beta OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=psmB PE=3 SV=1 29 211 2.0E-16
sp|Q5JDJ9|PSB1_THEKO Proteasome subunit beta 1 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmB1 PE=3 SV=1 29 210 2.0E-16
sp|Q4JAY3|PSB1_SULAC Proteasome subunit beta 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=psmB1 PE=3 SV=1 31 220 3.0E-16
sp|P34065|PSB5_CHICK Proteasome subunit beta type-5 (Fragment) OS=Gallus gallus GN=PSMB5 PE=2 SV=2 29 204 4.0E-16
sp|Q975U8|PSB1_SULTO Proteasome subunit beta 1 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=psmB1 PE=3 SV=1 31 220 6.0E-16
sp|B8D673|PSB1_DESK1 Proteasome subunit beta 1 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=psmB1 PE=3 SV=1 31 207 6.0E-16
sp|Q5W416|PSB8_CANLF Proteasome subunit beta type-8 OS=Canis lupus familiaris GN=PSMB8 PE=1 SV=1 29 223 8.0E-16
sp|B1YDJ0|PSB2_PYRNV Proteasome subunit beta 2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=psmB2 PE=3 SV=1 27 207 1.0E-15
sp|B6YSW2|PSB1_THEON Proteasome subunit beta 1 OS=Thermococcus onnurineus (strain NA1) GN=psmB1 PE=3 SV=1 29 210 1.0E-15
sp|P28064|PSB8_RAT Proteasome subunit beta type-8 OS=Rattus norvegicus GN=Psmb8 PE=1 SV=3 29 210 2.0E-15
sp|Q9HR36|PSB_HALSA Proteasome subunit beta OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=psmB PE=3 SV=2 28 213 2.0E-15
sp|B0R4C8|PSB_HALS3 Proteasome subunit beta OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=psmB PE=3 SV=1 28 213 2.0E-15
sp|Q4JAA8|PSB2_SULAC Proteasome subunit beta 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=psmB2 PE=3 SV=1 29 210 2.0E-15
sp|A1RSJ8|PSB1_PYRIL Proteasome subunit beta 1 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=psmB1 PE=3 SV=1 26 207 3.0E-15
sp|A5UM14|PSB_METS3 Proteasome subunit beta OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=psmB PE=3 SV=1 29 210 5.0E-15
sp|A3MXQ6|PSB2_PYRCJ Proteasome subunit beta 2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=psmB2 PE=3 SV=1 26 207 8.0E-15
sp|Q5V1D5|PSB2_HALMA Proteasome subunit beta 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=psmB2 PE=3 SV=1 28 208 2.0E-14
sp|P28062|PSB8_HUMAN Proteasome subunit beta type-8 OS=Homo sapiens GN=PSMB8 PE=1 SV=3 29 223 2.0E-14
sp|P28063|PSB8_MOUSE Proteasome subunit beta type-8 OS=Mus musculus GN=Psmb8 PE=1 SV=2 29 210 2.0E-14
sp|O27270|PSB_METTH Proteasome subunit beta OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=psmB PE=3 SV=1 24 211 3.0E-14
sp|Q6L181|PSB_PICTO Proteasome subunit beta OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=psmB PE=3 SV=1 28 229 3.0E-14
sp|C6A2V9|PSB1_THESM Proteasome subunit beta 1 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=psmB1 PE=3 SV=1 29 211 4.0E-14
sp|Q9V122|PSA_PYRAB Proteasome subunit alpha OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=psmA PE=3 SV=1 24 208 1.0E-13
sp|Q3T112|PSB8_BOVIN Proteasome subunit beta type-8 OS=Bos taurus GN=PSMB8 PE=1 SV=2 29 218 2.0E-13
sp|Q3IPX1|PSB_NATPD Proteasome subunit beta OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=psmB PE=3 SV=1 40 214 3.0E-13
sp|C7NQ99|PSB_HALUD Proteasome subunit beta OS=Halorhabdus utahensis (strain DSM 12940 / JCM 11049 / AX-2) GN=psmB PE=3 SV=1 40 218 4.0E-13
sp|C6A459|PSA_THESM Proteasome subunit alpha OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=psmA PE=3 SV=1 24 230 5.0E-13
sp|Q8TYB7|PSA_METKA Proteasome subunit alpha OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=psmA PE=3 SV=1 24 207 5.0E-13
sp|A0RU86|PSB1_CENSY Proteasome subunit beta 1 OS=Cenarchaeum symbiosum (strain A) GN=psmB1 PE=3 SV=1 29 210 1.0E-12
sp|Q0RLT7|PSB_FRAAA Proteasome subunit beta OS=Frankia alni (strain ACN14a) GN=prcB PE=3 SV=2 6 199 1.0E-12
sp|A8MBW0|PSB1_CALMQ Proteasome subunit beta 1 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=psmB1 PE=3 SV=1 40 210 1.0E-12
sp|Q8U4C9|PSB1_PYRFU Proteasome subunit beta 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=psmB1 PE=3 SV=1 27 219 1.0E-12
sp|O59219|PSA_PYRHO Proteasome subunit alpha OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=psmA PE=3 SV=1 24 208 1.0E-12
sp|O57983|PSB1_PYRHO Proteasome subunit beta 1 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=psmB1 PE=3 SV=1 27 220 2.0E-12
sp|D2RUI0|PSB2_HALTV Proteasome subunit beta 2 OS=Haloterrigena turkmenica (strain ATCC 51198 / DSM 5511 / NCIMB 13204 / VKM B-1734) GN=psmB2 PE=3 SV=1 38 215 2.0E-12
sp|D3SSQ6|PSB_NATMM Proteasome subunit beta OS=Natrialba magadii (strain ATCC 43099 / DSM 3394 / NCIMB 2190 / MS3) GN=psmB PE=3 SV=1 40 208 2.0E-12
sp|Q60177|PSA_METJA Proteasome subunit alpha OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=psmA PE=1 SV=1 24 208 3.0E-12
sp|C5A2D5|PSB2_THEGJ Proteasome subunit beta 2 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=psmB2 PE=3 SV=1 27 210 3.0E-12
sp|O24733|PSA_THEK1 Proteasome subunit alpha OS=Thermococcus sp. (strain JCM 11816 / KS-1) GN=psmA PE=3 SV=1 24 211 5.0E-12
sp|Q5JIU9|PSA_THEKO Proteasome subunit alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmA PE=3 SV=1 24 211 5.0E-12
sp|A8AA46|PSB1_IGNH4 Proteasome subunit beta 1 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=psmB1 PE=3 SV=1 29 207 5.0E-12
sp|Q8U0L6|PSA_PYRFU Proteasome subunit alpha OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=psmA PE=3 SV=1 24 220 8.0E-12
sp|Q9V247|PSB1_PYRAB Proteasome subunit beta 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=psmB1 PE=3 SV=1 27 219 1.0E-11
sp|A8LH54|PSB_FRASN Proteasome subunit beta OS=Frankia sp. (strain EAN1pec) GN=prcB PE=3 SV=1 17 199 2.0E-11
sp|C6A3R1|PSB2_THESM Proteasome subunit beta 2 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=psmB2 PE=3 SV=1 27 223 2.0E-11
sp|Q2J9Q3|PSB_FRASC Proteasome subunit beta OS=Frankia sp. (strain CcI3) GN=prcB PE=3 SV=2 6 210 3.0E-11
sp|O26782|PSA_METTH Proteasome subunit alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=psmA PE=3 SV=1 24 209 4.0E-11
sp|D2RQX3|PSB1_HALTV Proteasome subunit beta 1 OS=Haloterrigena turkmenica (strain ATCC 51198 / DSM 5511 / NCIMB 13204 / VKM B-1734) GN=psmB1 PE=3 SV=1 40 208 4.0E-11
sp|Q5JHL8|PSB2_THEKO Proteasome subunit beta 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmB2 PE=3 SV=1 27 210 9.0E-11
sp|A4YJ04|PSB2_METS5 Proteasome subunit beta 2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=psmB2 PE=3 SV=1 30 210 2.0E-10
sp|P57697|PSA_HALSA Proteasome subunit alpha OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=psmA PE=3 SV=1 24 213 4.0E-10
sp|B0R2T2|PSA_HALS3 Proteasome subunit alpha OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=psmA PE=3 SV=1 24 213 4.0E-10
sp|C5A2C2|PSA_THEGJ Proteasome subunit alpha OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=psmA PE=3 SV=1 24 211 6.0E-10
sp|A4X744|PSB2_SALTO Proteasome subunit beta 2 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=prcB2 PE=3 SV=2 21 199 7.0E-10
sp|Q9V2V6|PSA1_HALVD Proteasome subunit alpha 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=psmA1 PE=1 SV=2 24 210 7.0E-10
sp|A5LHX3|PSB11_HUMAN Proteasome subunit beta type-11 OS=Homo sapiens GN=PSMB11 PE=2 SV=1 29 204 7.0E-10
sp|Q5V4S6|PSB1_HALMA Proteasome subunit beta 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=psmB1 PE=3 SV=1 40 210 8.0E-10
sp|A5UJS2|PSA_METS3 Proteasome subunit alpha OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=psmA PE=3 SV=1 24 207 8.0E-10
sp|C7LYP7|PSB_ACIFD Proteasome subunit beta OS=Acidimicrobium ferrooxidans (strain DSM 10331 / JCM 15462 / NBRC 103882 / ICP) GN=prcB PE=3 SV=1 2 200 1.0E-09
sp|Q9LSU1|PSA5_ORYSJ Proteasome subunit alpha type-5 OS=Oryza sativa subsp. japonica GN=PAE1 PE=2 SV=1 24 210 1.0E-09
sp|A4TB64|PSB_MYCGI Proteasome subunit beta OS=Mycobacterium gilvum (strain PYR-GCK) GN=prcB PE=3 SV=1 6 199 2.0E-09
sp|C7NVQ4|PSB_HALMD Proteasome subunit beta OS=Halomicrobium mukohataei (strain ATCC 700874 / DSM 12286 / JCM 9738 / NCIMB 13541) GN=psmB PE=3 SV=1 41 210 3.0E-09
sp|D1BHT9|PSB_SANKS Proteasome subunit beta OS=Sanguibacter keddieii (strain ATCC 51767 / DSM 10542 / NCFB 3025 / ST-74) GN=prcB PE=3 SV=1 29 199 3.0E-09
sp|Q8TPX5|PSA_METAC Proteasome subunit alpha OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=psmA PE=3 SV=1 24 208 3.0E-09
sp|Q97BZ8|PSA_THEVO Proteasome subunit alpha OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=psmA PE=3 SV=2 24 192 6.0E-09
sp|O81149|PSA5A_ARATH Proteasome subunit alpha type-5-A OS=Arabidopsis thaliana GN=PAE1 PE=1 SV=1 24 207 6.0E-09
sp|Q42134|PSA5B_ARATH Proteasome subunit alpha type-5-B OS=Arabidopsis thaliana GN=PAE2 PE=1 SV=2 24 207 6.0E-09
sp|Q469M6|PSA_METBF Proteasome subunit alpha OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=psmA PE=3 SV=1 24 188 6.0E-09
sp|Q9M4T8|PSA5_SOYBN Proteasome subunit alpha type-5 OS=Glycine max GN=PAE1 PE=2 SV=1 24 207 7.0E-09
sp|P42742|PSB1_ARATH Proteasome subunit beta type-1 OS=Arabidopsis thaliana GN=PBF1 PE=1 SV=2 16 215 7.0E-09
sp|Q8PTU1|PSA_METMA Proteasome subunit alpha OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=psmA PE=3 SV=1 24 208 7.0E-09
sp|Q5V1D4|PSA2_HALMA Proteasome subunit alpha 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=psmA2 PE=3 SV=1 24 216 1.0E-08
sp|Q5VRG3|PSA4B_ORYSJ Proteasome subunit alpha type-4-2 OS=Oryza sativa subsp. japonica GN=Os06g0167600 PE=2 SV=1 24 229 2.0E-08
sp|P0C8Y9|PSA4B_ORYSI Proteasome subunit alpha type-4-2 OS=Oryza sativa subsp. indica GN=OsI_021067 PE=1 SV=1 24 229 2.0E-08
sp|P40304|PSB1_DROME Proteasome subunit beta type-1 OS=Drosophila melanogaster GN=Prosbeta6 PE=2 SV=2 3 210 2.0E-08
sp|A6VIP0|PSA_METM7 Proteasome subunit alpha OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=psmA PE=3 SV=1 24 207 2.0E-08
sp|A4FZT6|PSA_METM5 Proteasome subunit alpha OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=psmA PE=3 SV=1 24 207 2.0E-08
sp|P0C1G8|PSA4A_ORYSJ Proteasome subunit alpha type-4-1 OS=Oryza sativa subsp. japonica GN=PAC1 PE=2 SV=1 24 229 4.0E-08
sp|A2Y9X7|PSA4A_ORYSI Proteasome subunit alpha type-4-1 OS=Oryza sativa subsp. indica GN=OsI_021120 PE=1 SV=2 24 229 4.0E-08
sp|Q8BG41|PSB11_MOUSE Proteasome subunit beta type-11 OS=Mus musculus GN=Psmb11 PE=1 SV=1 29 238 4.0E-08
sp|Q23237|PSB3_CAEEL Proteasome subunit beta type-3 OS=Caenorhabditis elegans GN=pbs-3 PE=1 SV=1 28 214 4.0E-08
sp|B6YSH9|PSA_THEON Proteasome subunit alpha OS=Thermococcus onnurineus (strain NA1) GN=psmA PE=3 SV=1 24 208 4.0E-08
sp|P25156|PSA_THEAC Proteasome subunit alpha OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=psmA PE=1 SV=2 24 188 5.0E-08
sp|Q6M0L9|PSA_METMP Proteasome subunit alpha OS=Methanococcus maripaludis (strain S2 / LL) GN=psmA PE=3 SV=1 24 207 5.0E-08
sp|Q47NZ4|PSB_THEFY Proteasome subunit beta OS=Thermobifida fusca (strain YX) GN=prcB PE=3 SV=1 26 199 7.0E-08
sp|Q6L0W3|PSA_PICTO Proteasome subunit alpha OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=psmA PE=3 SV=1 24 195 8.0E-08
sp|B6YXV3|PSB2_THEON Proteasome subunit beta 2 OS=Thermococcus onnurineus (strain NA1) GN=psmB2 PE=3 SV=1 40 223 9.0E-08
sp|Q94561|PSA5_ENTHI Proteasome subunit alpha type-5 OS=Entamoeba histolytica PE=3 SV=2 24 211 1.0E-07
sp|A9A846|PSA_METM6 Proteasome subunit alpha OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=psmA PE=3 SV=1 24 207 1.0E-07
sp|B1W306|PSB_STRGG Proteasome subunit beta OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=prcB PE=3 SV=1 29 199 1.0E-07
sp|Q59565|PSA_METTE Proteasome subunit alpha OS=Methanosarcina thermophila GN=psmA PE=3 SV=1 24 223 2.0E-07
sp|A6W970|PSB_KINRD Proteasome subunit beta OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=prcB PE=3 SV=1 30 199 2.0E-07
sp|A4FBY1|PSB_SACEN Proteasome subunit beta OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=prcB PE=3 SV=1 6 199 2.0E-07
sp|Q828I8|PSB2_STRAW Proteasome subunit beta 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=prcB2 PE=3 SV=1 29 199 2.0E-07
sp|D2Q4H4|PSB_KRIFD Proteasome subunit beta OS=Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399) GN=prcB PE=3 SV=1 22 181 3.0E-07
sp|Q1B797|PSB_MYCSS Proteasome subunit beta OS=Mycobacterium sp. (strain MCS) GN=prcB PE=3 SV=1 25 199 4.0E-07
sp|A1UHS7|PSB_MYCSK Proteasome subunit beta OS=Mycobacterium sp. (strain KMS) GN=prcB PE=3 SV=1 25 199 4.0E-07
sp|A3Q193|PSB_MYCSJ Proteasome subunit beta OS=Mycobacterium sp. (strain JLS) GN=prcB PE=3 SV=1 25 199 4.0E-07
sp|D1A2S9|PSB1_THECD Proteasome subunit beta 1 OS=Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / NCIMB 10081) GN=prcB1 PE=3 SV=1 17 199 4.0E-07
sp|A9WSI1|PSB_RENSM Proteasome subunit beta OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=prcB PE=3 SV=1 22 199 5.0E-07
sp|O29760|PSA_ARCFU Proteasome subunit alpha OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=psmA PE=1 SV=1 24 223 6.0E-07
sp|Q7AKQ5|PSB_STRCO Proteasome subunit beta OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=prcB PE=1 SV=1 29 205 8.0E-07
sp|P23638|PSA3_YEAST Proteasome subunit alpha type-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE9 PE=1 SV=1 31 184 1.0E-06
sp|C7R403|PSB_JONDD Proteasome subunit beta OS=Jonesia denitrificans (strain ATCC 14870 / DSM 20603 / CIP 55134) GN=prcB PE=3 SV=1 29 188 1.0E-06
sp|A7I9C7|PSA_METB6 Proteasome subunit alpha OS=Methanoregula boonei (strain 6A8) GN=psmA PE=3 SV=1 24 188 2.0E-06
sp|Q5V2X8|PSA1_HALMA Proteasome subunit alpha 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=psmA1 PE=3 SV=1 24 228 2.0E-06
sp|A1SK13|PSB_NOCSJ Proteasome subunit beta OS=Nocardioides sp. (strain BAA-499 / JS614) GN=prcB PE=3 SV=1 29 247 2.0E-06
sp|P52427|PSA4_SPIOL Proteasome subunit alpha type-4 OS=Spinacia oleracea GN=PAC1 PE=2 SV=1 24 243 2.0E-06
sp|B8H8L6|PSB_ARTCA Proteasome subunit beta OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=prcB PE=3 SV=1 6 199 2.0E-06
sp|C8XAQ4|PSB_NAKMY Proteasome subunit beta OS=Nakamurella multipartita (strain ATCC 700099 / DSM 44233 / JCM 9543 / Y-104) GN=prcB PE=3 SV=1 29 199 3.0E-06
sp|O23708|PSA2A_ARATH Proteasome subunit alpha type-2-A OS=Arabidopsis thaliana GN=PAB1 PE=1 SV=1 25 211 3.0E-06
sp|Q73YW8|PSB_MYCPA Proteasome subunit beta OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=prcB PE=3 SV=1 29 199 3.0E-06
sp|A0QFB5|PSB_MYCA1 Proteasome subunit beta OS=Mycobacterium avium (strain 104) GN=prcB PE=3 SV=1 29 199 3.0E-06
sp|A0QZ47|PSB_MYCS2 Proteasome subunit beta OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=prcB PE=1 SV=2 25 199 3.0E-06
sp|A1R6Q7|PSB_ARTAT Proteasome subunit beta OS=Arthrobacter aurescens (strain TC1) GN=prcB PE=3 SV=2 30 199 4.0E-06
sp|C9Z4D0|PSB_STRSW Proteasome subunit beta OS=Streptomyces scabiei (strain 87.22) GN=prcB PE=3 SV=1 29 199 4.0E-06
sp|Q9U793|PSA2_TRYBB Proteasome subunit alpha type-2 OS=Trypanosoma brucei brucei PE=2 SV=1 25 215 5.0E-06
sp|O82530|PSA4_PETHY Proteasome subunit alpha type-4 OS=Petunia hybrida GN=PAC1 PE=2 SV=1 24 219 5.0E-06
sp|Q09682|PSA3_SCHPO Probable proteasome subunit alpha type-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13C5.01c PE=3 SV=1 33 212 6.0E-06
sp|D2S6E2|PSB_GEOOG Proteasome subunit beta OS=Geodermatophilus obscurus (strain ATCC 25078 / DSM 43160 / JCM 3152 / G-20) GN=prcB PE=3 SV=1 20 199 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005839 proteasome core complex Yes
GO:0051603 proteolysis involved in cellular protein catabolic process Yes
GO:0004298 threonine-type endopeptidase activity Yes
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0005575 cellular_component No
GO:0006508 proteolysis No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0004175 endopeptidase activity No
GO:0071704 organic substance metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0070003 threonine-type peptidase activity No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0008233 peptidase activity No
GO:0044464 cell part No
GO:0019538 protein metabolic process No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0044424 intracellular part No
GO:0032991 protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7838
MPGFDFSNYNRNAALHARGVPLPKATSTGTTIVGCIFDGGVVIAADTRATSGPIVADKNCEKLHYISPQIWCAGA
GTAADTEFTTSLISSQLELHALSTGRKPRVVTCMTLLKQHLFRYQGYIGAYLVVAGCDPTGTHLFTVHAHGSTDK
LPYVTMGSGSLAAMSVFETQWRAALTRDQAVRLASDAILAGIFNDLGSGSNVDVAVITADKTTLMRNFIRPNEKS
AKLQSYAFPKGTTAVLNEKVIERKDLGRYVSVHDVPLETEKMDVDP*
Coding >Hirsu2|7838
ATGCCGGGCTTCGACTTCTCCAACTACAACCGCAATGCGGCCCTGCACGCCCGCGGGGTGCCTCTGCCCAAGGCC
ACCAGCACGGGCACGACCATCGTCGGATGCATCTTTGACGGGGGCGTCGTGATCGCGGCCGACACGCGAGCGACG
TCGGGCCCGATCGTGGCCGACAAGAACTGCGAGAAGCTGCACTACATCTCGCCGCAGATCTGGTGCGCGGGGGCC
GGGACGGCGGCCGACACCGAGTTCACGACGAGCCTCATCTCGTCGCAGCTGGAGCTGCACGCGCTGTCGACGGGC
CGAAAGCCGCGCGTGGTGACGTGCATGACGCTGCTGAAGCAGCACCTCTTCCGCTACCAGGGCTACATCGGCGCC
TACCTGGTCGTCGCCGGCTGTGACCCGACCGGCACCCACCTCTTCACCGTGCACGCCCACGGCAGCACCGACAAG
CTGCCGTACGTGACGATGGGCAGCGGCAGCCTGGCCGCCATGAGCGTCTTCGAGACGCAGTGGCGCGCCGCCCTG
ACGCGCGACCAGGCCGTCCGCCTCGCCAGCGACGCCATCCTCGCCGGCATCTTCAACGACCTCGGCTCCGGCTCC
AACGTCGACGTGGCCGTCATCACCGCCGACAAGACGACTCTCATGCGCAACTTCATCCGCCCCAACGAGAAGAGC
GCCAAGCTGCAGAGCTACGCCTTCCCCAAGGGCACCACCGCCGTCCTCAACGAGAAGGTCATCGAGAGGAAGGAC
CTGGGCCGCTACGTCAGCGTCCACGACGTGCCCCTCGAGACGGAGAAGATGGACGTCGACCCCTGA
Transcript >Hirsu2|7838
ATGCCGGGCTTCGACTTCTCCAACTACAACCGCAATGCGGCCCTGCACGCCCGCGGGGTGCCTCTGCCCAAGGCC
ACCAGCACGGGCACGACCATCGTCGGATGCATCTTTGACGGGGGCGTCGTGATCGCGGCCGACACGCGAGCGACG
TCGGGCCCGATCGTGGCCGACAAGAACTGCGAGAAGCTGCACTACATCTCGCCGCAGATCTGGTGCGCGGGGGCC
GGGACGGCGGCCGACACCGAGTTCACGACGAGCCTCATCTCGTCGCAGCTGGAGCTGCACGCGCTGTCGACGGGC
CGAAAGCCGCGCGTGGTGACGTGCATGACGCTGCTGAAGCAGCACCTCTTCCGCTACCAGGGCTACATCGGCGCC
TACCTGGTCGTCGCCGGCTGTGACCCGACCGGCACCCACCTCTTCACCGTGCACGCCCACGGCAGCACCGACAAG
CTGCCGTACGTGACGATGGGCAGCGGCAGCCTGGCCGCCATGAGCGTCTTCGAGACGCAGTGGCGCGCCGCCCTG
ACGCGCGACCAGGCCGTCCGCCTCGCCAGCGACGCCATCCTCGCCGGCATCTTCAACGACCTCGGCTCCGGCTCC
AACGTCGACGTGGCCGTCATCACCGCCGACAAGACGACTCTCATGCGCAACTTCATCCGCCCCAACGAGAAGAGC
GCCAAGCTGCAGAGCTACGCCTTCCCCAAGGGCACCACCGCCGTCCTCAACGAGAAGGTCATCGAGAGGAAGGAC
CTGGGCCGCTACGTCAGCGTCCACGACGTGCCCCTCGAGACGGAGAAGATGGACGTCGACCCCTGA
Gene >Hirsu2|7838
ATGCCGGGCTTCGACTTCTCCAACTACAACCGCAATGCGGCCCTGCACGCCCGCGGGGTGCCTCTGCCCAAGGCC
ACCAGCACGGGCACGACCATCGTCGGATGCATCTTTGACGGGGGCGTCGTGGTGCGTGCTTTCCTTTCCTCGCTC
GCCCTCTCCCCTGGCCTTTTCCCCTGCACGACTCCCTCGTAGTAACCCCATGAGGGGGGGGAATAGGGAGCTCCA
TGCCCGAGACGCCCACGGACGGCGAGAGCAAGACGCTAATCTAATTTTTTCCCACACTCTCGCGGGTGTTTAGAT
CGCGGCCGACACGCGAGCGACGTCGGGCCCGATCGTGGCCGACAAGAACTGCGAGAAGCTGCACTACATCTCGCC
GCAGATCTGGTGCGCGGGGGCCGGGACGGCGGCCGACACCGAGTTCACGACGAGCCTCATCTCGTCGCAGCTGGA
GCTGCACGCGCTGTCGACGGGCCGAAAGCCGCGCGTGGTGACGTGCATGACGCTGCTGAAGCAGCACCTCTTCCG
CTACCAGGGCTACATCGGCGCCTACCTGGTCGTCGCCGGCTGTGACCCGACCGGCACCCACCTCTTCACCGTGCA
CGCCCACGGCAGCACCGACAAGCTGCCGTACGTGACGATGGGCAGCGGCAGCCTGGCCGCCATGAGCGTCTTCGA
GACGCAGTGGCGCGCCGCCCTGACGCGCGACCAGGCCGTCCGCCTCGCCAGCGACGCCATCCTCGCCGGCATCTT
CAACGACCTCGGCTCCGGCTCCAACGTCGACGTGGCCGTCATCACCGCCGACAAGACGACTCTCATGCGCAACTT
CATCCGCCCCAACGAGAAGAGCGCCAAGCTGCAGAGCTACGCCTTCCCCAAGGGCACCACCGCCGTCCTCAACGA
GAAGGTCATCGAGAGGAAGGACCTGGGCCGCTACGTCAGCGTCCACGACGTGCCCCTCGAGACGGAGAAGATGGA
CGTCGACCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail