Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7831
Gene name
LocationContig_479:14836..16203
Strand+
Gene length (bp)1367
Transcript length (bp)1290
Coding sequence length (bp)1290
Protein length (aa) 430

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily 7.8E-36 122 348
PF06839 zf-GRF GRF zinc finger 2.5E-06 361 405

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8K1E6|ALKB3_MOUSE Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Mus musculus GN=Alkbh3 PE=1 SV=1 240 361 1.0E-11
sp|Q5XIC8|ALKB3_RAT Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Rattus norvegicus GN=Alkbh3 PE=2 SV=1 240 360 2.0E-11
sp|Q32L00|ALKB3_BOVIN Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Bos taurus GN=ALKBH3 PE=2 SV=1 240 352 1.0E-10
sp|Q96Q83|ALKB3_HUMAN Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Homo sapiens GN=ALKBH3 PE=1 SV=1 240 352 2.0E-10
sp|Q9SIE0|ALKB2_ARATH DNA oxidative demethylase ALKBH2 OS=Arabidopsis thaliana GN=ALKBH2 PE=2 SV=2 240 348 4.0E-10

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4022 0.8895 0.0232 0.0157 0.1059 0.0088 0.0489 0.0501 0.0832 0.0079

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, GRF-type

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3932
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|122
Ophiocordyceps australis map64 (Brazil) OphauB2|2755
Ophiocordyceps camponoti-floridani Ophcf2|04015
Ophiocordyceps camponoti-rufipedis Ophun1|1979
Ophiocordyceps kimflemingae Ophio5|8573
Ophiocordyceps subramaniannii Hirsu2|7831 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7831
MESFLARPKRKSAAVAEAGAGDDDEPTEVKLALLSSLHAGIDQETILDVLLAHDGSVSRASAALRTSQPEARKTG
VIGHQQSLKRYALAGPSASPGYKKVKSKRGSTLHLYDPEDVAEHTPCTIIHDFLPPDVANDLLAELLAEAESFEK
PTFKLFDNVVSSPHTSSFFVESYDAMRSQKADYYYNGSRLTDVRRITPQLAKVKPAVQEAVNGEIQRRIATRYPG
GRKLRFQSPERWLPNSAFVNCYRGGQESVGWHSDQLTYLGPRAVIGSVSLGVAREFRVRRVLPRDADGRDADAEG
QLSIHLPHNSLLVMHAEMQEEWKHCVAPAPSIDPHPVAGNRRINITYRDYRPAMHPRHTPRCACAVPCVLRVVQR
RTDSFGRYFWMCHAGNVPGKSGCPFFQWAEFDDDGNPLAGGGGGGAAPAAAPTA*
Coding >Hirsu2|7831
ATGGAGTCATTCCTCGCGCGCCCGAAGCGGAAATCAGCAGCCGTGGCCGAGGCCGGCGCCGGCGACGACGACGAG
CCGACGGAGGTAAAGCTGGCGCTTCTGTCGTCTCTGCACGCCGGGATCGACCAGGAGACGATCCTGGATGTCCTC
CTGGCGCACGACGGGTCCGTGAGCCGGGCCTCGGCTGCGCTCAGGACAAGCCAGCCCGAGGCGAGGAAGACGGGC
GTGATCGGGCATCAGCAGTCGCTGAAGAGATACGCGCTGGCCGGCCCGTCGGCCTCGCCGGGCTACAAGAAGGTC
AAGTCGAAAAGGGGGAGCACGCTGCACCTGTACGACCCCGAGGACGTGGCGGAACACACGCCCTGCACCATCATC
CACGACTTTCTGCCGCCAGACGTCGCCAACGACCTGCTGGCGGAGCTACTGGCAGAGGCCGAGTCGTTTGAGAAG
CCGACGTTCAAGCTGTTCGACAATGTCGTCTCGAGCCCGCACACGTCCAGCTTCTTCGTCGAGAGCTACGACGCC
ATGCGGTCGCAGAAGGCCGACTACTACTACAACGGATCCAGACTGACGGACGTGCGGCGCATCACGCCCCAGCTG
GCCAAGGTCAAGCCGGCGGTGCAGGAGGCCGTCAACGGGGAGATCCAGCGGCGGATCGCGACGCGGTACCCGGGC
GGGCGCAAGCTGCGCTTCCAGTCGCCCGAGCGCTGGCTGCCCAACTCGGCCTTTGTCAACTGCTACCGCGGCGGG
CAGGAGAGCGTCGGCTGGCACAGCGACCAGCTGACGTACCTGGGGCCGCGCGCCGTCATCGGGTCCGTGTCGCTG
GGCGTGGCGCGCGAGTTCCGCGTGCGCCGGGTGCTGCCGCGCGACGCCGACGGCCGCGACGCCGACGCCGAGGGC
CAGCTGTCGATCCACCTGCCGCACAACTCGCTGCTGGTGATGCACGCCGAGATGCAGGAGGAGTGGAAGCACTGC
GTCGCGCCCGCGCCCTCCATCGACCCGCACCCGGTCGCCGGCAACCGGCGCATCAACATCACGTACCGCGACTAC
CGGCCGGCCATGCACCCGCGCCACACACCCCGCTGCGCGTGCGCGGTGCCGTGCGTCCTGCGCGTCGTCCAGCGC
AGGACCGACAGCTTCGGCCGCTACTTCTGGATGTGCCACGCCGGCAACGTGCCCGGCAAGTCCGGCTGCCCGTTC
TTCCAGTGGGCCGAGTTCGACGACGACGGGAACCCGCTCGCCGGCGGCGGCGGCGGCGGCGCAGCGCCCGCGGCC
GCCCCCACGGCTTGA
Transcript >Hirsu2|7831
ATGGAGTCATTCCTCGCGCGCCCGAAGCGGAAATCAGCAGCCGTGGCCGAGGCCGGCGCCGGCGACGACGACGAG
CCGACGGAGGTAAAGCTGGCGCTTCTGTCGTCTCTGCACGCCGGGATCGACCAGGAGACGATCCTGGATGTCCTC
CTGGCGCACGACGGGTCCGTGAGCCGGGCCTCGGCTGCGCTCAGGACAAGCCAGCCCGAGGCGAGGAAGACGGGC
GTGATCGGGCATCAGCAGTCGCTGAAGAGATACGCGCTGGCCGGCCCGTCGGCCTCGCCGGGCTACAAGAAGGTC
AAGTCGAAAAGGGGGAGCACGCTGCACCTGTACGACCCCGAGGACGTGGCGGAACACACGCCCTGCACCATCATC
CACGACTTTCTGCCGCCAGACGTCGCCAACGACCTGCTGGCGGAGCTACTGGCAGAGGCCGAGTCGTTTGAGAAG
CCGACGTTCAAGCTGTTCGACAATGTCGTCTCGAGCCCGCACACGTCCAGCTTCTTCGTCGAGAGCTACGACGCC
ATGCGGTCGCAGAAGGCCGACTACTACTACAACGGATCCAGACTGACGGACGTGCGGCGCATCACGCCCCAGCTG
GCCAAGGTCAAGCCGGCGGTGCAGGAGGCCGTCAACGGGGAGATCCAGCGGCGGATCGCGACGCGGTACCCGGGC
GGGCGCAAGCTGCGCTTCCAGTCGCCCGAGCGCTGGCTGCCCAACTCGGCCTTTGTCAACTGCTACCGCGGCGGG
CAGGAGAGCGTCGGCTGGCACAGCGACCAGCTGACGTACCTGGGGCCGCGCGCCGTCATCGGGTCCGTGTCGCTG
GGCGTGGCGCGCGAGTTCCGCGTGCGCCGGGTGCTGCCGCGCGACGCCGACGGCCGCGACGCCGACGCCGAGGGC
CAGCTGTCGATCCACCTGCCGCACAACTCGCTGCTGGTGATGCACGCCGAGATGCAGGAGGAGTGGAAGCACTGC
GTCGCGCCCGCGCCCTCCATCGACCCGCACCCGGTCGCCGGCAACCGGCGCATCAACATCACGTACCGCGACTAC
CGGCCGGCCATGCACCCGCGCCACACACCCCGCTGCGCGTGCGCGGTGCCGTGCGTCCTGCGCGTCGTCCAGCGC
AGGACCGACAGCTTCGGCCGCTACTTCTGGATGTGCCACGCCGGCAACGTGCCCGGCAAGTCCGGCTGCCCGTTC
TTCCAGTGGGCCGAGTTCGACGACGACGGGAACCCGCTCGCCGGCGGCGGCGGCGGCGGCGCAGCGCCCGCGGCC
GCCCCCACGGCTTGA
Gene >Hirsu2|7831
ATGGAGTCATTCCTCGCGCGCCCGAAGCGGAAATCAGCAGCCGTGGCCGAGGCCGGCGCCGGCGACGACGACGAG
CCGACGGAGGTAAAGCTGGCGCTTCTGTCGTCTCTGCACGCCGGGATCGACCAGGAGACGATCCTGGATGTCCTC
CTGGCGCACGACGGGTCCGTGAGCCGGGCCTCGGCTGCGCTCAGGACAAGCCAGCCCGAGGCGAGGAAGACGGGC
GTGATCGGGCATCAGCAGTCGCTGAAGAGATACGCGCTGGCCGGCCCGTCGGCCTCGCCGGGCTACAAGAAGGTC
AAGTCGAAAAGGGGGAGCACGCTGCACCTGTACGACCCCGAGGACGTGGCGGAACACACGCCCTGCACCATCATC
CACGACTTTCTGCCGCCAGACGTCGCCAACGACCTGCTGGCGGAGCTACTGGCAGAGGCCGAGTCGTTTGAGAAG
CCGACGTTCAAGCTGTTCGACAATGTCGTCTCGAGCCCGCACACGTCCAGCTTCTTCGTCGAGAGCTACGACGCC
ATGCGGTCGCAGAAGGCCGACTACTACTACAACGGATCCAGACTGACGGCAAGTCGGCGCCCGTCCGTCCATACG
GGGCGCGAAACGCGACGAGGGCTGACGGTGGGGGCTTTCGCCTCACGCAGGACGTGCGGCGCATCACGCCCCAGC
TGGCCAAGGTCAAGCCGGCGGTGCAGGAGGCCGTCAACGGGGAGATCCAGCGGCGGATCGCGACGCGGTACCCGG
GCGGGCGCAAGCTGCGCTTCCAGTCGCCCGAGCGCTGGCTGCCCAACTCGGCCTTTGTCAACTGCTACCGCGGCG
GGCAGGAGAGCGTCGGCTGGCACAGCGACCAGCTGACGTACCTGGGGCCGCGCGCCGTCATCGGGTCCGTGTCGC
TGGGCGTGGCGCGCGAGTTCCGCGTGCGCCGGGTGCTGCCGCGCGACGCCGACGGCCGCGACGCCGACGCCGAGG
GCCAGCTGTCGATCCACCTGCCGCACAACTCGCTGCTGGTGATGCACGCCGAGATGCAGGAGGAGTGGAAGCACT
GCGTCGCGCCCGCGCCCTCCATCGACCCGCACCCGGTCGCCGGCAACCGGCGCATCAACATCACGTACCGCGACT
ACCGGCCGGCCATGCACCCGCGCCACACACCCCGCTGCGCGTGCGCGGTGCCGTGCGTCCTGCGCGTCGTCCAGC
GCAGGACCGACAGCTTCGGCCGCTACTTCTGGATGTGCCACGCCGGCAACGTGCCCGGCAAGTCCGGCTGCCCGT
TCTTCCAGTGGGCCGAGTTCGACGACGACGGGAACCCGCTCGCCGGCGGCGGCGGCGGCGGCGCAGCGCCCGCGG
CCGCCCCCACGGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail