Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|783
Gene name
LocationContig_1161:1741..3901
Strand-
Gene length (bp)2160
Transcript length (bp)1914
Coding sequence length (bp)1914
Protein length (aa) 638

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family 8.6E-34 185 348

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9C2N1|VIB1_NEUCR Transcription factor vib-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vib-1 PE=3 SV=1 11 591 0.0E+00
sp|Q05534|PHOG_EMENI Protein pacG OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pacG PE=3 SV=3 129 362 3.0E-65

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2236 0.9613 0.0236 0.0111 0.0138 0.0029 0.0377 0.0414 0.0034 0.0041

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup974
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6671
Ophiocordyceps australis 1348a (Ghana) OphauG2|6672
Ophiocordyceps australis map64 (Brazil) OphauB2|2872
Ophiocordyceps camponoti-floridani Ophcf2|04880
Ophiocordyceps camponoti-rufipedis Ophun1|5193
Ophiocordyceps kimflemingae Ophio5|6216
Ophiocordyceps subramaniannii Hirsu2|783 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|783
MMTAAAYPATMTELRGEPAHSSIWSNYSGSTHLPSRLGGVMDSPFHGSSAAAAAAAAASHAARPRSGHGGSLDHH
QAAYPYRGYSQDEPSPYDRHPSYSNLKRSFSQAEPPAYQEIVQDLRDDGSRLNVNQDHKLLAFRRAQDKTTIVDQ
HGRVQQLDLSAQLHGMFFLSEMPSSASDGSVIQPELTCYRRNLFQISGSLVMPRGQLSVVNESNETVPVSNMEVA
ISAIESVDGNPVRLIVIPWKTPPPNSPEVNQTPDQEPPTLPLIPFQDDGADTEGELAVYPIGWRRLQFRIATANN
GRRKELQQHFVLHLKVFGTLADSSKVVLTESTTAPIVVRGRSPRNFQARKEIPLLGSSAGSRGQALVETGLGVVA
SALSLRQDTKARSMDMQVPRSSFTFSPPKPQGSTLSSLRSNSYPSWSSQVSGSSPGAYPSTSLGADSYPKLPLSG
AAGFSTEAQEMPLQTSMAPSVPLPLPGNDQSQSSLRSHYSYASGPQLSDSAFSMPRYVDSNPRPSKSPRQSGHQS
VHSSGSISNTDTSSEYRYGSYRGTGSSGAGDGSHQTYPPPSSWTTTSSEQNSSLAYAGSDGRSYSFSHEPYKSGG
ASAIPPLKHETASSSVYGGGGSRGSFDTMNNYSWSTA*
Coding >Hirsu2|783
ATGATGACCGCGGCAGCATACCCGGCTACCATGACGGAGCTGAGGGGCGAGCCAGCTCACTCCAGCATCTGGTCC
AACTACAGCGGCTCGACGCACCTGCCCAGCCGCCTGGGAGGCGTCATGGACTCGCCCTTCCACGGCTCCTCGGCC
GCCGCCGCCGCCGCCGCCGCCGCCTCCCACGCGGCCCGCCCCCGGAGCGGCCACGGCGGCTCGCTGGACCATCAC
CAGGCCGCCTACCCCTACCGCGGCTACTCCCAGGACGAGCCCAGCCCCTACGACCGCCACCCGAGCTACTCGAAC
CTCAAGCGCTCCTTCTCCCAGGCCGAGCCGCCCGCCTACCAGGAGATCGTCCAGGACCTGCGCGACGACGGCTCG
CGCCTCAACGTCAACCAGGACCACAAGCTGCTGGCCTTCCGCCGCGCCCAGGACAAGACCACCATTGTCGACCAG
CACGGCCGCGTCCAGCAGCTCGACCTCTCGGCCCAGCTGCACGGCATGTTCTTCCTGTCCGAGATGCCGTCCAGC
GCCAGCGACGGCTCCGTCATCCAGCCCGAGTTGACCTGCTACCGCCGCAACCTCTTCCAGATCAGCGGCTCGCTC
GTCATGCCGCGCGGCCAGCTCTCCGTCGTCAACGAGTCCAACGAGACGGTCCCCGTCTCCAACATGGAGGTGGCC
ATCTCCGCCATCGAGTCCGTCGACGGCAACCCCGTCCGCCTCATCGTCATCCCCTGGAAGACGCCGCCGCCCAAC
TCGCCCGAGGTCAACCAGACGCCCGACCAGGAGCCCCCCACCCTGCCCCTGATCCCCTTCCAGGACGACGGCGCC
GACACCGAGGGCGAGCTGGCCGTCTATCCCATCGGCTGGCGGCGTCTGCAGTTCCGGATAGCGACGGCGAACAAC
GGCCGCAGGAAAGAGCTCCAGCAACACTTCGTCCTCCACCTCAAGGTTTTCGGCACCCTGGCCGACAGCTCCAAG
GTGGTCCTGACCGAATCGACGACGGCCCCGATCGTGGTGCGAGGCCGCAGCCCGCGGAACTTCCAGGCCCGCAAG
GAGATCCCCCTCCTCGGCTCCAGCGCCGGCTCCAGGGGCCAGGCTCTGGTCGAGACGGGCCTGGGCGTCGTCGCC
AGCGCGCTGAGCCTGCGGCAGGACACCAAGGCGAGGAGCATGGACATGCAGGTCCCGCGATCCTCCTTCACCTTC
AGCCCCCCGAAACCGCAGGGGAGCACGCTGAGTTCGCTGCGGTCAAACTCGTATCCATCCTGGAGCTCGCAGGTG
TCGGGCTCGAGCCCGGGGGCGTACCCGTCGACATCGCTGGGCGCCGACTCGTACCCCAAGCTGCCGCTCTCGGGC
GCGGCCGGCTTCTCGACGGAGGCGCAGGAGATGCCGCTGCAGACGTCGATGGCGCCGTCGGTGCCGCTGCCGCTG
CCGGGCAACGACCAGTCGCAGTCGTCGCTGCGGTCGCACTACTCGTACGCGTCGGGGCCGCAGCTGTCGGACAGC
GCCTTCAGCATGCCGCGCTACGTCGACAGCAACCCGCGGCCGTCCAAGAGCCCGCGGCAGTCGGGCCACCAGTCG
GTGCACAGCTCGGGCTCCATCAGCAACACGGACACGTCGTCCGAGTACCGGTACGGCTCCTACCGCGGCACCGGC
AGCAGCGGCGCCGGCGACGGCTCCCACCAGACGTACCCGCCGCCCAGCTCGTGGACGACGACGTCGTCGGAGCAG
AACTCGAGCTTGGCCTACGCCGGCAGCGACGGCCGCTCCTATTCCTTCTCGCACGAGCCCTACAAGAGCGGCGGC
GCCTCGGCCATCCCGCCCCTGAAGCACGAGACGGCCTCCTCCAGCGTCTACGGCGGCGGCGGCTCGCGCGGCTCC
TTCGACACCATGAACAACTATTCCTGGAGCACGGCCTAG
Transcript >Hirsu2|783
ATGATGACCGCGGCAGCATACCCGGCTACCATGACGGAGCTGAGGGGCGAGCCAGCTCACTCCAGCATCTGGTCC
AACTACAGCGGCTCGACGCACCTGCCCAGCCGCCTGGGAGGCGTCATGGACTCGCCCTTCCACGGCTCCTCGGCC
GCCGCCGCCGCCGCCGCCGCCGCCTCCCACGCGGCCCGCCCCCGGAGCGGCCACGGCGGCTCGCTGGACCATCAC
CAGGCCGCCTACCCCTACCGCGGCTACTCCCAGGACGAGCCCAGCCCCTACGACCGCCACCCGAGCTACTCGAAC
CTCAAGCGCTCCTTCTCCCAGGCCGAGCCGCCCGCCTACCAGGAGATCGTCCAGGACCTGCGCGACGACGGCTCG
CGCCTCAACGTCAACCAGGACCACAAGCTGCTGGCCTTCCGCCGCGCCCAGGACAAGACCACCATTGTCGACCAG
CACGGCCGCGTCCAGCAGCTCGACCTCTCGGCCCAGCTGCACGGCATGTTCTTCCTGTCCGAGATGCCGTCCAGC
GCCAGCGACGGCTCCGTCATCCAGCCCGAGTTGACCTGCTACCGCCGCAACCTCTTCCAGATCAGCGGCTCGCTC
GTCATGCCGCGCGGCCAGCTCTCCGTCGTCAACGAGTCCAACGAGACGGTCCCCGTCTCCAACATGGAGGTGGCC
ATCTCCGCCATCGAGTCCGTCGACGGCAACCCCGTCCGCCTCATCGTCATCCCCTGGAAGACGCCGCCGCCCAAC
TCGCCCGAGGTCAACCAGACGCCCGACCAGGAGCCCCCCACCCTGCCCCTGATCCCCTTCCAGGACGACGGCGCC
GACACCGAGGGCGAGCTGGCCGTCTATCCCATCGGCTGGCGGCGTCTGCAGTTCCGGATAGCGACGGCGAACAAC
GGCCGCAGGAAAGAGCTCCAGCAACACTTCGTCCTCCACCTCAAGGTTTTCGGCACCCTGGCCGACAGCTCCAAG
GTGGTCCTGACCGAATCGACGACGGCCCCGATCGTGGTGCGAGGCCGCAGCCCGCGGAACTTCCAGGCCCGCAAG
GAGATCCCCCTCCTCGGCTCCAGCGCCGGCTCCAGGGGCCAGGCTCTGGTCGAGACGGGCCTGGGCGTCGTCGCC
AGCGCGCTGAGCCTGCGGCAGGACACCAAGGCGAGGAGCATGGACATGCAGGTCCCGCGATCCTCCTTCACCTTC
AGCCCCCCGAAACCGCAGGGGAGCACGCTGAGTTCGCTGCGGTCAAACTCGTATCCATCCTGGAGCTCGCAGGTG
TCGGGCTCGAGCCCGGGGGCGTACCCGTCGACATCGCTGGGCGCCGACTCGTACCCCAAGCTGCCGCTCTCGGGC
GCGGCCGGCTTCTCGACGGAGGCGCAGGAGATGCCGCTGCAGACGTCGATGGCGCCGTCGGTGCCGCTGCCGCTG
CCGGGCAACGACCAGTCGCAGTCGTCGCTGCGGTCGCACTACTCGTACGCGTCGGGGCCGCAGCTGTCGGACAGC
GCCTTCAGCATGCCGCGCTACGTCGACAGCAACCCGCGGCCGTCCAAGAGCCCGCGGCAGTCGGGCCACCAGTCG
GTGCACAGCTCGGGCTCCATCAGCAACACGGACACGTCGTCCGAGTACCGGTACGGCTCCTACCGCGGCACCGGC
AGCAGCGGCGCCGGCGACGGCTCCCACCAGACGTACCCGCCGCCCAGCTCGTGGACGACGACGTCGTCGGAGCAG
AACTCGAGCTTGGCCTACGCCGGCAGCGACGGCCGCTCCTATTCCTTCTCGCACGAGCCCTACAAGAGCGGCGGC
GCCTCGGCCATCCCGCCCCTGAAGCACGAGACGGCCTCCTCCAGCGTCTACGGCGGCGGCGGCTCGCGCGGCTCC
TTCGACACCATGAACAACTATTCCTGGAGCACGGCCTAG
Gene >Hirsu2|783
ATGATGACCGCGGCAGCATACCCGGCTACCATGACGGAGCTGAGGGGCGAGCCAGCTCACTCCAGCATCTGGTCC
AACTACAGCGGCTCGACGCACCTGCCCAGCCGCCTGGGAGGCGTCATGGACTCGCCCTTCCACGGCTCCTCGGCC
GCCGCCGCCGCCGCCGCCGCCGCCTCCCACGCGGCCCGCCCCCGGAGCGGCCACGGCGGCTCGCTGGACCATCAC
CAGGCCGCCTACCCCTACCGCGGCTACTCCCAGGACGAGCCCAGCCCCTACGACCGCCACCCGAGCTACTCGAAC
CTCAAGCGCTCCTTCTCCCAGGCCGAGCCGCCCGCCTACCAGGAGATCGTCCAGGACCTGCGCGACGACGGCTCG
CGCCTCAACGTCAACCAGGACCACAAGCTGCTGGCCTTCCGCCGCGCCCAGGACAAGACCACCATTGTCGACCAG
CACGGCCGCGTCCAGCAGCTCGACCTCTCGGCCCAGCTGCACGGCATGTTCTTCCTGTCCGAGATGCCGTCCAGC
GCCAGCGACGGCTCCGTCATCCAGCCCGAGTTGACCTGCTACCGCCGCAACCTCTTCCAGATCAGCGGCTCGCTC
GTCATGCCGCGCGGCCAGCTCTCCGTCGTCAACGAGTCCAACGAGACGGTCCCCGTCTCCAACATGGAGGTGGCC
ATCTCCGCCATCGAGTCCGTCGACGGCAACCCCGTCCGCCTCATCGTCATCCCCTGGAAGACGCCGCCGCCCAAC
TCGCCCGAGGTCAACCAGACGCCCGACCAGGAGCCCCCCACCCTGCCCCTGATCCCCTTCCAGGACGACGGCGCC
GACACCGAGGGCGAGCTGGCCGTCTATCCCATCGGCTGGCGGCGTCTGCAGTTCCGGATGTAAGTCTGAACCGCC
CCCCCCCCTCTTTTTCTCTTCATCCTCGTCCCCTCGCCCGGCTCGTTGGCTAAAGAAAGACCCGCGACACGTCAG
AGCGACGGCGAACAACGGCCGCAGGAAAGAGCTCCAGCAACACTTCGTCCTCCACCTCAAGGTTTTCGGCACCCT
GGCCGACAGCTCCAAGGTGGTCCTGACCGAATCGACGACGGCCCCGATCGTGGTGCGAGGCCGCAGCCCGCGGAA
CTTCCAGGCCCGCAAGGAGATCCCCCTCCTCGGCTCCAGCGCCGGCTCCAGGGGCCAGGCTCTGGTCGAGACGGG
CCTGGGCGTCGTCGCCAGCGCGCTGAGCCTGCGGCAGGACACCAAGGCGAGGAGCATGGACATGCAGGTCCCGCG
ATCCTCCTTCACCTTCAGCCCCCCGAAACCGCAGGGGAGCACGCTGAGTTCGCTGCGGTCAAAGTGAGTAGCCCC
CCCCAAGTTTGCGCGCCGAGAAGTTCAGCTTCGCGCATGGAAGAAGGAGAGAGATGGAGGGAGAGAGAAGAAGAA
CAAGCGAAGAGGAGACATAGTACACAGAGAGGAGAAGACAAAGAGGCTGACTCGGAGACCCACCGCAGCTCGTAT
CCATCCTGGAGCTCGCAGGTGTCGGGCTCGAGCCCGGGGGCGTACCCGTCGACATCGCTGGGCGCCGACTCGTAC
CCCAAGCTGCCGCTCTCGGGCGCGGCCGGCTTCTCGACGGAGGCGCAGGAGATGCCGCTGCAGACGTCGATGGCG
CCGTCGGTGCCGCTGCCGCTGCCGGGCAACGACCAGTCGCAGTCGTCGCTGCGGTCGCACTACTCGTACGCGTCG
GGGCCGCAGCTGTCGGACAGCGCCTTCAGCATGCCGCGCTACGTCGACAGCAACCCGCGGCCGTCCAAGAGCCCG
CGGCAGTCGGGCCACCAGTCGGTGCACAGCTCGGGCTCCATCAGCAACACGGACACGTCGTCCGAGTACCGGTAC
GGCTCCTACCGCGGCACCGGCAGCAGCGGCGCCGGCGACGGCTCCCACCAGACGTACCCGCCGCCCAGCTCGTGG
ACGACGACGTCGTCGGAGCAGAACTCGAGCTTGGCCTACGCCGGCAGCGACGGCCGCTCCTATTCCTTCTCGCAC
GAGCCCTACAAGAGCGGCGGCGCCTCGGCCATCCCGCCCCTGAAGCACGAGACGGCCTCCTCCAGCGTCTACGGC
GGCGGCGGCTCGCGCGGCTCCTTCGACACCATGAACAACTATTCCTGGAGCACGGCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail