Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7824
Gene name
LocationContig_478:16860..17858
Strand+
Gene length (bp)998
Transcript length (bp)801
Coding sequence length (bp)801
Protein length (aa) 267

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14622 Ribonucleas_3_3 Ribonuclease-III-like 1.2E-24 108 255

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0006396 RNA processing Yes
GO:0004525 ribonuclease III activity Yes
GO:0140098 catalytic activity, acting on RNA No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0004521 endoribonuclease activity No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0032296 double-stranded RNA-specific ribonuclease activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0004518 nuclease activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0016893 endonuclease activity, active with either ribo- or deoxyribonucleic acids and producing 5'-phosphomonoesters No
GO:0016070 RNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016891 endoribonuclease activity, producing 5'-phosphomonoesters No
GO:0004519 endonuclease activity No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0004540 ribonuclease activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 215 237 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7824
MALQPCRTALARGRHAARFLAPSLRASLGTDAAPPTGETDVAAAAANNQLSSGLPRWSHTPPAMKAPLQMDFAKK
AKNKIWAVNNDPERLDDMYERLLGPRGKHMLPDELKWLAVTHKSFDQGRRGFNDRLALMGRVTLLMETTKYIVSK
TPNDDARAPDEFGRQPFEHPQLAPVDNLNAESPRDVVGKDKLYGLAHQVGLVAVMRWKPRIPDRLYASGIETVMS
AAIMAIVGAITLQHGSVVASEVVRKRILDRVRILDRMRSSR*
Coding >Hirsu2|7824
ATGGCGCTGCAGCCCTGCCGTACGGCGCTCGCACGAGGGCGGCACGCGGCTCGATTCCTGGCGCCGTCGCTGCGG
GCCTCGCTCGGCACCGACGCCGCGCCGCCGACGGGCGAAACGGACGTTGCCGCCGCCGCCGCCAACAACCAGCTG
TCGTCGGGCCTGCCGAGATGGAGCCACACGCCGCCGGCGATGAAGGCACCGCTCCAGATGGACTTCGCCAAGAAG
GCCAAGAACAAGATCTGGGCCGTCAACAATGACCCCGAGCGCCTCGACGACATGTACGAGCGCTTGCTGGGCCCG
CGCGGCAAGCACATGCTCCCTGACGAGCTCAAGTGGCTGGCCGTGACGCACAAGAGCTTCGACCAAGGGCGGCGC
GGATTCAACGATCGATTGGCCCTCATGGGCCGAGTTACCCTGCTGATGGAAACGACCAAGTACATCGTCAGCAAG
ACGCCCAACGACGACGCGCGGGCCCCGGACGAGTTTGGCAGGCAGCCCTTCGAGCACCCGCAGCTGGCGCCCGTC
GACAACCTCAACGCCGAGAGCCCGAGAGACGTGGTCGGCAAGGATAAGCTGTACGGCCTGGCGCACCAGGTCGGA
CTGGTCGCCGTGATGCGGTGGAAGCCCCGGATTCCCGACCGACTGTACGCGTCCGGTATCGAGACGGTCATGAGC
GCCGCCATCATGGCCATTGTCGGGGCCATCACGCTGCAGCACGGATCCGTGGTGGCGTCCGAGGTTGTGAGGAAA
CGAATCCTGGACAGGGTGCGGATCCTAGATAGGATGCGGAGCAGTCGCTGA
Transcript >Hirsu2|7824
ATGGCGCTGCAGCCCTGCCGTACGGCGCTCGCACGAGGGCGGCACGCGGCTCGATTCCTGGCGCCGTCGCTGCGG
GCCTCGCTCGGCACCGACGCCGCGCCGCCGACGGGCGAAACGGACGTTGCCGCCGCCGCCGCCAACAACCAGCTG
TCGTCGGGCCTGCCGAGATGGAGCCACACGCCGCCGGCGATGAAGGCACCGCTCCAGATGGACTTCGCCAAGAAG
GCCAAGAACAAGATCTGGGCCGTCAACAATGACCCCGAGCGCCTCGACGACATGTACGAGCGCTTGCTGGGCCCG
CGCGGCAAGCACATGCTCCCTGACGAGCTCAAGTGGCTGGCCGTGACGCACAAGAGCTTCGACCAAGGGCGGCGC
GGATTCAACGATCGATTGGCCCTCATGGGCCGAGTTACCCTGCTGATGGAAACGACCAAGTACATCGTCAGCAAG
ACGCCCAACGACGACGCGCGGGCCCCGGACGAGTTTGGCAGGCAGCCCTTCGAGCACCCGCAGCTGGCGCCCGTC
GACAACCTCAACGCCGAGAGCCCGAGAGACGTGGTCGGCAAGGATAAGCTGTACGGCCTGGCGCACCAGGTCGGA
CTGGTCGCCGTGATGCGGTGGAAGCCCCGGATTCCCGACCGACTGTACGCGTCCGGTATCGAGACGGTCATGAGC
GCCGCCATCATGGCCATTGTCGGGGCCATCACGCTGCAGCACGGATCCGTGGTGGCGTCCGAGGTTGTGAGGAAA
CGAATCCTGGACAGGGTGCGGATCCTAGATAGGATGCGGAGCAGTCGCTGA
Gene >Hirsu2|7824
ATGGCGCTGCAGCCCTGCCGTACGGCGCTCGCACGAGGGCGGCACGCGGCTCGATTCCTGGCGCCGTCGCTGCGG
GCCTCGCTCGGCACCGACGCCGCGCCGCCGACGGGCGAAACGGACGTTGCCGCCGCCGCCGCCAACAACCAGCTG
TCGTCGGGCCTGCCGAGATGGAGCCACACGCCGCCGGCGATGAAGGCACCGCTCCAGATGGACTTCGCCAAGAAG
GCCAAGAACAAGATCTGGGCCGTCAACAATGACCCCGAGCGCCTCGACGACATGTACGAGCGCTTGCTGGGCCCG
CGCGGCAAGCACATGCTCCCTGACGAGCTCAAGTGGCTGGCCGTGACGCACAAGAGCTTCGACCAAGGGCGGCGC
GGATTCAACGATCGATTGGCCCTCATGGGTACGTTCAGACGCCGGCCCATCCGTCCTCGATCGCGTCTCGCCCCC
CTTCTGGCCTCGTTTTACCATTTTCCCCACGAGACCGACTAGGAGCCCGGGCGGATGACAATCGTGCTAATGCGG
ACGCGTTCCTCGGGCCAGGCCGAGTTACCCTGCTGATGGAAACGACCAAGTACATCGTCAGCAAGACGCCCAACG
ACGACGCGCGGGCCCCGGACGAGTTTGGCAGGCAGCCCTTCGAGCACCCGCAGCTGGCGCCCGTCGACAACCTCA
ACGCCGAGAGCCCGAGAGACGTGGTCGGCAAGGATAAGCTGTACGGCCTGGCGCACCAGGTCGGACTGGTCGCCG
TGATGCGGTGGAAGCCCCGGATTGTAGGTCGCGCCCTCTCCGCCCGAGCCCTTGCGCGCGGCTGACACTGCCGAC
GACAGCCCGACCGACTGTACGCGTCCGGTATCGAGACGGTCATGAGCGCCGCCATCATGGCCATTGTCGGGGCCA
TCACGCTGCAGCACGGATCCGTGGTGGCGTCCGAGGTTGTGAGGAAACGAATCCTGGACAGGGTGCGGATCCTAG
ATAGGATGCGGAGCAGTCGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail