Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7816
Gene name
LocationContig_477:13330..17134
Strand+
Gene length (bp)3804
Transcript length (bp)3558
Coding sequence length (bp)3558
Protein length (aa) 1186

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00520 Ion_trans Ion transport protein 2.4E-06 381 582

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12324|YVC1_YEAST Calcium channel YVC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YVC1 PE=1 SV=2 351 654 2.0E-15
sp|Q5A2J7|YVC1_CANAL Calcium channel YVC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YVC1 PE=2 SV=1 350 647 7.0E-15
sp|Q9R283|TRPC2_RAT Short transient receptor potential channel 2 OS=Rattus norvegicus GN=Trpc2 PE=2 SV=2 253 590 2.0E-09
sp|Q9R244|TRPC2_MOUSE Short transient receptor potential channel 2 OS=Mus musculus GN=Trpc2 PE=2 SV=2 253 590 7.0E-09

GO

GO Term Description Terminal node
GO:0005216 ion channel activity Yes
GO:0006811 ion transport Yes
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0015267 channel activity No
GO:0008150 biological_process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0022803 passive transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0005215 transporter activity No
GO:0022838 substrate-specific channel activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 360 377 17
2 384 406 22
3 421 443 22
4 456 478 22
5 493 512 19
6 524 543 19
7 553 575 22
8 604 621 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7816
MFSSLLRRPKNARRRVDARDGSPPLSSRPAPRRHITGRTHATADFTEADDDDDEDEDDSDDDSHPGPANRRRPPP
SRQPPDDGPEDDADEDGSPKALPVLPLFSATHLDALPVYSITHAIRIIVTTRTETTLTWEQLRSPQVSQFLVKPM
QQQIRTQHFSRVTLYALMANCLQFGKEGQRYAANAGTSNTRAKVCELLALKLLKEYSTRELIDALAYDFYPLQGL
PGAQAPLPQARNYSKAKQALTASRTSTLEVAIRASAKHFLAHPVVVQQLEAIWNGAITFYASADRLHREAPSSPF
RGMNGSAAAPDSRTPLLGSLPPKQPPDSAPPGRRTVMLYDPRQASMLKLSRLRVPRYRSFLSTLSLAVLIGLFLA
VLVRRSVQITGLELVFWFWSAGFMLDELVGFNEQGFALYIMSFWNIFDLGILVLLIAYYCMRAYGVFLVDPHHWN
AMAYDVLAANAILLLPRIFSVLDHYQYFSQLLIALRLMAVDLAAVFVLVLIMCSGFYVFFTLSQSASANDGGDVA
YKIFQILMGFTPAAWDIWPQYNWLARVLMMMFLIICHFLIVTILITVLTNSFMTIASNATEEHQFLFAINTISMV
KNDALFSYIAPSNIFAWLLMPLRYCMPLKHFVWLNRTIIKFTHFPVLFCIYLYERFWLAPSVYEPTDLVENHGRS
RPRTISFRDPVERTAMFSPNVRVREESVAGFHKDRALEEVFRRLPEASTLRTQRRNERRKTQTAIRNWMDQNDDA
GMPLSNWPTLESRAVPDWHRRLSVGWERSSHLRHVSDVRSTASDPADFVSNHEAPHGRGPGSRRPNVAALDYKDQ
TDADADGDDELVTNDEDEDDAGTNADRSHQYEKLGVEEEDYFTTPIPTRSAKLPTSHPSPVQNAASLAPQPILQR
RGGHSRSVSTNTILYKPEELPRVYSSSSSRSPPQAGPGRKAGPSGRNTGANTPAAAGRRSSPRRPVVLLPSSQPR
PILAPRGLTETGGVSRTAMLSLDPHDRLRQARRLSSVDLSVLSDNFGADDPIAGMAGSFQTQMAMAMMKDNRLRV
AGGIDVADRDRMGRLVLARMKTLEESFADVIKEMRDLKNSSTAPQSQRNSSGEELKGATADTSGQERAKRAAGKG
DATPKKGYGKRPVSRRSMREGKVGMLARPDLKGKGKEVRYSTTDDEAEAEGSLALRGSSM*
Coding >Hirsu2|7816
ATGTTCTCCTCGCTGCTGCGCCGCCCCAAGAATGCTCGCCGTCGCGTCGACGCCCGCGACGGGAGCCCGCCGCTC
TCCTCCCGCCCCGCCCCTCGCCGCCACATTACCGGTCGCACCCACGCCACCGCCGACTTTACCGAGGCCGACGAC
GACGACGACGAAGACGAAGACGACTCCGATGACGACTCCCACCCCGGCCCTGCGAACCGTCGCCGCCCTCCTCCC
TCCCGACAGCCTCCCGACGACGGTCCGGAAGATGACGCGGACGAGGATGGCAGCCCCAAGGCCCTGCCCGTCCTC
CCGCTCTTCTCCGCCACCCATCTCGACGCCCTGCCCGTGTACAGCATCACCCACGCCATACGCATCATCGTGACC
ACCCGCACCGAGACGACCCTCACCTGGGAGCAGCTGCGTTCGCCCCAGGTCTCCCAGTTCCTGGTCAAGCCGATG
CAGCAGCAGATCCGGACCCAGCACTTTTCCCGCGTCACCCTATATGCCCTCATGGCCAATTGCCTGCAGTTCGGC
AAGGAGGGGCAGCGCTATGCCGCCAATGCCGGCACCAGCAACACGAGGGCCAAGGTCTGCGAGCTCCTCGCCCTC
AAACTCCTCAAGGAGTACAGCACCAGGGAGCTCATCGATGCCCTTGCCTACGACTTCTATCCCCTCCAAGGCCTG
CCCGGCGCCCAGGCGCCCCTCCCCCAGGCCAGAAACTACTCCAAGGCCAAGCAGGCCTTGACGGCGTCGCGGACG
TCGACGCTCGAGGTGGCCATCCGCGCCTCGGCCAAGCATTTCCTTGCCCATCCCGTCGTGGTCCAGCAGCTCGAG
GCCATATGGAATGGCGCCATCACCTTCTACGCCTCCGCCGACCGCTTGCACCGCGAGGCCCCGTCGAGCCCCTTC
CGCGGCATGAACGGGAGTGCCGCCGCGCCGGACTCGAGGACCCCCCTGCTCGGCTCCCTGCCGCCCAAGCAGCCT
CCCGACTCGGCTCCGCCCGGACGGAGGACGGTGATGCTCTACGATCCCCGCCAGGCCTCCATGCTCAAGCTCTCC
CGCCTCCGCGTCCCGCGCTACCGCTCCTTCCTCTCCACCCTCTCCCTCGCCGTCCTCATAGGCCTCTTCCTCGCC
GTCCTCGTCCGGCGGTCGGTGCAGATCACCGGCCTCGAGCTGGTCTTCTGGTTCTGGAGTGCCGGCTTCATGCTG
GACGAGCTGGTTGGCTTCAACGAGCAGGGCTTCGCCCTCTACATCATGAGCTTCTGGAACATCTTCGACCTCGGC
ATCCTCGTCCTGCTGATAGCCTACTACTGCATGCGTGCCTACGGTGTCTTCCTCGTCGACCCCCACCACTGGAAC
GCCATGGCATACGACGTTCTGGCGGCCAATGCCATCCTGTTGCTGCCGCGCATCTTCAGCGTCCTCGACCACTAC
CAGTACTTCTCCCAGCTGCTCATCGCCCTCCGCCTCATGGCTGTCGACCTGGCCGCCGTCTTCGTCCTGGTCTTG
ATCATGTGCAGCGGCTTCTACGTCTTCTTCACCCTTTCGCAGAGTGCCAGTGCCAACGACGGCGGCGACGTCGCC
TACAAGATTTTCCAGATTCTCATGGGCTTCACCCCCGCCGCCTGGGACATCTGGCCACAGTACAACTGGCTCGCG
CGGGTACTCATGATGATGTTTCTCATCATTTGCCATTTCTTGATCGTGACGATTCTCATCACGGTGTTGACCAAC
TCCTTCATGACCATTGCCTCGAACGCCACCGAGGAGCATCAGTTCCTGTTTGCCATCAACACAATCTCCATGGTC
AAGAATGACGCCCTGTTCTCCTACATAGCCCCCAGCAACATCTTTGCCTGGCTGCTCATGCCCCTGCGCTACTGC
ATGCCGCTGAAGCACTTCGTCTGGCTGAACCGGACCATCATCAAATTCACGCACTTCCCCGTGCTGTTTTGCATC
TATCTCTACGAGCGGTTCTGGCTGGCCCCGTCCGTGTACGAGCCGACGGACCTGGTCGAGAACCACGGCCGGAGC
AGGCCCCGGACAATTTCGTTCCGAGACCCGGTTGAGAGGACGGCCATGTTCAGCCCCAACGTCCGGGTGCGCGAG
GAGTCCGTGGCGGGGTTCCACAAGGACCGGGCGCTGGAGGAAGTCTTCCGGCGCCTGCCGGAAGCCAGCACCCTG
CGGACCCAGCGGCGGAACGAGAGGCGCAAGACGCAGACGGCCATCCGCAACTGGATGGACCAGAACGACGACGCC
GGCATGCCCCTGTCCAACTGGCCGACGCTGGAGAGCCGGGCGGTGCCGGACTGGCATAGGCGGCTGAGCGTCGGC
TGGGAGCGCTCGTCCCACCTCCGACACGTCTCCGACGTCAGGTCGACGGCGAGCGACCCGGCCGACTTCGTGTCG
AACCACGAGGCGCCCCATGGACGCGGGCCCGGATCGCGGCGGCCGAACGTGGCGGCGCTCGACTACAAGGACCAG
ACCGACGCGGACGCGGACGGCGACGACGAGCTGGTGACAAACGACGAGGACGAGGACGACGCGGGGACGAATGCG
GACCGCAGCCACCAGTACGAAAAGCTCGGGGTGGAGGAGGAGGACTACTTCACGACGCCGATCCCGACGCGCTCG
GCCAAGCTGCCGACGTCTCACCCGTCGCCGGTGCAGAACGCCGCGTCGCTCGCCCCTCAACCGATCCTGCAGAGG
CGCGGGGGCCACAGCCGGTCGGTGTCGACCAACACGATACTGTACAAGCCGGAGGAGCTGCCGCGGGTGTACAGC
TCCTCGTCGTCCAGGTCGCCGCCGCAGGCCGGGCCGGGGCGAAAGGCCGGGCCGAGCGGGCGCAACACGGGGGCG
AACACGCCGGCGGCGGCGGGGCGGCGCAGCTCGCCGCGACGGCCGGTGGTGCTCTTGCCGAGCTCGCAGCCTCGG
CCGATCCTGGCGCCGCGCGGGCTGACGGAGACGGGAGGCGTCAGCCGGACGGCCATGCTCAGCCTGGACCCTCAC
GACCGGCTGCGACAGGCCAGGAGACTGTCGTCGGTGGACCTGAGCGTGCTCTCGGACAACTTCGGGGCGGACGAC
CCGATCGCGGGCATGGCCGGAAGCTTCCAGACGCAGATGGCCATGGCCATGATGAAGGACAACCGGCTCCGGGTG
GCGGGGGGCATCGACGTGGCCGACCGGGACAGGATGGGCCGACTGGTGCTGGCGCGGATGAAGACGCTGGAGGAG
AGCTTCGCGGACGTGATCAAGGAGATGCGGGACCTCAAGAACAGCTCGACGGCGCCGCAGTCGCAGAGGAACTCG
TCGGGCGAGGAGCTGAAAGGGGCGACGGCCGACACAAGCGGGCAGGAACGTGCCAAGAGAGCGGCGGGCAAGGGG
GACGCGACGCCAAAGAAGGGCTACGGCAAGAGGCCGGTGAGCCGGCGGAGCATGCGGGAGGGCAAGGTGGGCATG
CTGGCGCGGCCAGACTTGAAGGGCAAGGGCAAGGAGGTGAGGTACTCGACGACGGACGACGAGGCGGAAGCCGAG
GGAAGTCTGGCCTTGAGGGGGAGCTCGATGTGA
Transcript >Hirsu2|7816
ATGTTCTCCTCGCTGCTGCGCCGCCCCAAGAATGCTCGCCGTCGCGTCGACGCCCGCGACGGGAGCCCGCCGCTC
TCCTCCCGCCCCGCCCCTCGCCGCCACATTACCGGTCGCACCCACGCCACCGCCGACTTTACCGAGGCCGACGAC
GACGACGACGAAGACGAAGACGACTCCGATGACGACTCCCACCCCGGCCCTGCGAACCGTCGCCGCCCTCCTCCC
TCCCGACAGCCTCCCGACGACGGTCCGGAAGATGACGCGGACGAGGATGGCAGCCCCAAGGCCCTGCCCGTCCTC
CCGCTCTTCTCCGCCACCCATCTCGACGCCCTGCCCGTGTACAGCATCACCCACGCCATACGCATCATCGTGACC
ACCCGCACCGAGACGACCCTCACCTGGGAGCAGCTGCGTTCGCCCCAGGTCTCCCAGTTCCTGGTCAAGCCGATG
CAGCAGCAGATCCGGACCCAGCACTTTTCCCGCGTCACCCTATATGCCCTCATGGCCAATTGCCTGCAGTTCGGC
AAGGAGGGGCAGCGCTATGCCGCCAATGCCGGCACCAGCAACACGAGGGCCAAGGTCTGCGAGCTCCTCGCCCTC
AAACTCCTCAAGGAGTACAGCACCAGGGAGCTCATCGATGCCCTTGCCTACGACTTCTATCCCCTCCAAGGCCTG
CCCGGCGCCCAGGCGCCCCTCCCCCAGGCCAGAAACTACTCCAAGGCCAAGCAGGCCTTGACGGCGTCGCGGACG
TCGACGCTCGAGGTGGCCATCCGCGCCTCGGCCAAGCATTTCCTTGCCCATCCCGTCGTGGTCCAGCAGCTCGAG
GCCATATGGAATGGCGCCATCACCTTCTACGCCTCCGCCGACCGCTTGCACCGCGAGGCCCCGTCGAGCCCCTTC
CGCGGCATGAACGGGAGTGCCGCCGCGCCGGACTCGAGGACCCCCCTGCTCGGCTCCCTGCCGCCCAAGCAGCCT
CCCGACTCGGCTCCGCCCGGACGGAGGACGGTGATGCTCTACGATCCCCGCCAGGCCTCCATGCTCAAGCTCTCC
CGCCTCCGCGTCCCGCGCTACCGCTCCTTCCTCTCCACCCTCTCCCTCGCCGTCCTCATAGGCCTCTTCCTCGCC
GTCCTCGTCCGGCGGTCGGTGCAGATCACCGGCCTCGAGCTGGTCTTCTGGTTCTGGAGTGCCGGCTTCATGCTG
GACGAGCTGGTTGGCTTCAACGAGCAGGGCTTCGCCCTCTACATCATGAGCTTCTGGAACATCTTCGACCTCGGC
ATCCTCGTCCTGCTGATAGCCTACTACTGCATGCGTGCCTACGGTGTCTTCCTCGTCGACCCCCACCACTGGAAC
GCCATGGCATACGACGTTCTGGCGGCCAATGCCATCCTGTTGCTGCCGCGCATCTTCAGCGTCCTCGACCACTAC
CAGTACTTCTCCCAGCTGCTCATCGCCCTCCGCCTCATGGCTGTCGACCTGGCCGCCGTCTTCGTCCTGGTCTTG
ATCATGTGCAGCGGCTTCTACGTCTTCTTCACCCTTTCGCAGAGTGCCAGTGCCAACGACGGCGGCGACGTCGCC
TACAAGATTTTCCAGATTCTCATGGGCTTCACCCCCGCCGCCTGGGACATCTGGCCACAGTACAACTGGCTCGCG
CGGGTACTCATGATGATGTTTCTCATCATTTGCCATTTCTTGATCGTGACGATTCTCATCACGGTGTTGACCAAC
TCCTTCATGACCATTGCCTCGAACGCCACCGAGGAGCATCAGTTCCTGTTTGCCATCAACACAATCTCCATGGTC
AAGAATGACGCCCTGTTCTCCTACATAGCCCCCAGCAACATCTTTGCCTGGCTGCTCATGCCCCTGCGCTACTGC
ATGCCGCTGAAGCACTTCGTCTGGCTGAACCGGACCATCATCAAATTCACGCACTTCCCCGTGCTGTTTTGCATC
TATCTCTACGAGCGGTTCTGGCTGGCCCCGTCCGTGTACGAGCCGACGGACCTGGTCGAGAACCACGGCCGGAGC
AGGCCCCGGACAATTTCGTTCCGAGACCCGGTTGAGAGGACGGCCATGTTCAGCCCCAACGTCCGGGTGCGCGAG
GAGTCCGTGGCGGGGTTCCACAAGGACCGGGCGCTGGAGGAAGTCTTCCGGCGCCTGCCGGAAGCCAGCACCCTG
CGGACCCAGCGGCGGAACGAGAGGCGCAAGACGCAGACGGCCATCCGCAACTGGATGGACCAGAACGACGACGCC
GGCATGCCCCTGTCCAACTGGCCGACGCTGGAGAGCCGGGCGGTGCCGGACTGGCATAGGCGGCTGAGCGTCGGC
TGGGAGCGCTCGTCCCACCTCCGACACGTCTCCGACGTCAGGTCGACGGCGAGCGACCCGGCCGACTTCGTGTCG
AACCACGAGGCGCCCCATGGACGCGGGCCCGGATCGCGGCGGCCGAACGTGGCGGCGCTCGACTACAAGGACCAG
ACCGACGCGGACGCGGACGGCGACGACGAGCTGGTGACAAACGACGAGGACGAGGACGACGCGGGGACGAATGCG
GACCGCAGCCACCAGTACGAAAAGCTCGGGGTGGAGGAGGAGGACTACTTCACGACGCCGATCCCGACGCGCTCG
GCCAAGCTGCCGACGTCTCACCCGTCGCCGGTGCAGAACGCCGCGTCGCTCGCCCCTCAACCGATCCTGCAGAGG
CGCGGGGGCCACAGCCGGTCGGTGTCGACCAACACGATACTGTACAAGCCGGAGGAGCTGCCGCGGGTGTACAGC
TCCTCGTCGTCCAGGTCGCCGCCGCAGGCCGGGCCGGGGCGAAAGGCCGGGCCGAGCGGGCGCAACACGGGGGCG
AACACGCCGGCGGCGGCGGGGCGGCGCAGCTCGCCGCGACGGCCGGTGGTGCTCTTGCCGAGCTCGCAGCCTCGG
CCGATCCTGGCGCCGCGCGGGCTGACGGAGACGGGAGGCGTCAGCCGGACGGCCATGCTCAGCCTGGACCCTCAC
GACCGGCTGCGACAGGCCAGGAGACTGTCGTCGGTGGACCTGAGCGTGCTCTCGGACAACTTCGGGGCGGACGAC
CCGATCGCGGGCATGGCCGGAAGCTTCCAGACGCAGATGGCCATGGCCATGATGAAGGACAACCGGCTCCGGGTG
GCGGGGGGCATCGACGTGGCCGACCGGGACAGGATGGGCCGACTGGTGCTGGCGCGGATGAAGACGCTGGAGGAG
AGCTTCGCGGACGTGATCAAGGAGATGCGGGACCTCAAGAACAGCTCGACGGCGCCGCAGTCGCAGAGGAACTCG
TCGGGCGAGGAGCTGAAAGGGGCGACGGCCGACACAAGCGGGCAGGAACGTGCCAAGAGAGCGGCGGGCAAGGGG
GACGCGACGCCAAAGAAGGGCTACGGCAAGAGGCCGGTGAGCCGGCGGAGCATGCGGGAGGGCAAGGTGGGCATG
CTGGCGCGGCCAGACTTGAAGGGCAAGGGCAAGGAGGTGAGGTACTCGACGACGGACGACGAGGCGGAAGCCGAG
GGAAGTCTGGCCTTGAGGGGGAGCTCGATGTGA
Gene >Hirsu2|7816
ATGTTCTCCTCGCTGCTGCGCCGCCCCAAGAATGCTCGCCGTCGCGTCGACGCCCGCGACGGGAGCCCGCCGCTC
TCCTCCCGCCCCGCCCCTCGCCGCCACATTACCGGTCGCACCCACGCCACCGCCGACTTTACCGAGGCCGACGAC
GACGACGACGAAGACGAAGACGACTCCGATGACGACTCCCACCCCGGCCCTGCGAACCGTCGCCGCCCTCCTCCC
TCCCGACAGCCTCCCGACGACGGTCCGGAAGATGACGCGGACGAGGATGGCAGCCCCAAGGCCCTGCCCGTCCTC
CCGCTCTTCTCCGCCACCCATCTCGGTAACACCAAGATGCCCCCCCCCCCGCGTTTCTCTTGTCCGCTTCTGACG
CCTTCGCTCCGCAGACGCCCTGCCCGTGTACAGCATCACCCACGCCATACGCATCATCGTGACCACCCGCACCGA
GACGACCCTCACCTGGGAGCAGCTGCGTTCGCCCCAGGTCTCCCAGTTCCTGGTCAAGCCGATGCAGCAGCAGAT
CCGGACCCAGCACTTTTCCCGCGTCACCCTATATGCCCTCATGGCCAATTGCCTGCAGTTCGGCAAGGAGGGGCA
GCGCTATGCCGCCAATGCCGGCACCAGCAACACGAGGGCCAAGGTCTGCGAGCTCCTCGCCCTCAAACTCCTCAA
GGAGTACAGCACCAGGGAGCTCATCGATGCCCTTGCCTACGACTTCTATCCCCTCCAAGGCCTGCCCGGCGCCCA
GGCGCCCCTCCCCCAGGCCAGAAACTACTCCAAGGCCAAGCAGGCCTTGACGGCGTCGCGGACGTCGACGCTCGA
GGTGGCCATCCGCGCCTCGGCCAAGCATTTCCTTGCCCATCCCGTCGTGGTCCAGCAGCTCGAGGCCATATGGAA
TGGCGCCATCACCTTCTACGCCTCCGCCGACCGCTTGCACCGCGAGGCCCCGTCGAGCCCCTTCCGCGGCATGAA
CGGGAGTGCCGCCGCGCCGGACTCGAGGACCCCCCTGCTCGGCTCCCTGCCGCCCAAGCAGCCTCCCGACTCGGC
TCCGCCCGGACGGAGGACGGTGATGCTCTACGATCCCCGCCAGGCCTCCATGCTCAAGCTCTCCCGCCTCCGCGT
CCCGCGCTACCGCTCCTTCCTCTCCACCCTCTCCCTCGCCGTCCTCATAGGCCTCTTCCTCGCCGTCCTCGTCCG
GCGGTCGGTGCAGATCACCGGCCTCGAGCTGGTCTTCTGGTTCTGGAGTGCCGGCTTCATGCTGGACGAGCTGGT
TGGCTTCAACGAGCAGGGCTTCGCCCTCTACATCATGAGCTTCTGGAACATCTTCGACCTCGGCATCCTCGTCCT
GCTGATAGCCTACTACTGCATGCGTGCCTACGGTGTCTTCCTCGTCGACCCCCACCACTGGAACGCCATGGCATA
CGACGTTCTGGCGGCCAATGCCATCCTGTTGCTGCCGCGCATCTTCAGCGTCCTCGACCACTACCAGTACTTCTC
CCAGCTGCTCATCGCCCTCCGCCTCATGGCTGTCGACCTGGCCGCCGTCTTCGTCCTGGTCTTGATCATGTGCAG
CGGCTTCTACGTCTTCTTCACCCTTTCGCAGAGTGCCAGTGCCAACGACGGCGGCGACGTCGCCTACAAGATTTT
CCAGATTCTCATGGGCTTCACCCCCGCCGCCTGGGACATGTAAGCCGCGCCCGATTCCCTGCTCGCCACCGAACG
GACGTTGCTGACGGCGAACCAGCTGGCCACAGTACAACTGGCTCGCGCGGGTACTCATGATGATGTTTCTCATCA
TTTGCCATTTCTTGATCGTGTAAGTGACGCGCCACTCCCTCCGGCGAGCTGATTCTGTCTGACACGGGGGGCGGC
CCAGGACGATTCTCATCACGGTGTTGACCAACTCCTTCATGACCATTGCCTCGAACGCCACCGAGGAGCATCAGT
ACGTAATTTCCGTCCTCTACCGTCGACGTCGCCCCCCCCCCTGTACTCACGCGCACACGCAGGTTCCTGTTTGCC
ATCAACACAATCTCCATGGTCAAGAATGACGCCCTGTTCTCCTACATAGCCCCCAGCAACATCTTTGCCTGGCTG
CTCATGCCCCTGCGCTACTGCATGCCGCTGAAGCACTTCGTCTGGCTGAACCGGACCATCATCAAATTCACGCAC
TTCCCCGTGCTGTTTTGCATCTATCTCTACGAGCGGTTCTGGCTGGCCCCGTCCGTGTACGAGCCGACGGACCTG
GTCGAGAACCACGGCCGGAGCAGGCCCCGGACAATTTCGTTCCGAGACCCGGTTGAGAGGACGGCCATGTTCAGC
CCCAACGTCCGGGTGCGCGAGGAGTCCGTGGCGGGGTTCCACAAGGACCGGGCGCTGGAGGAAGTCTTCCGGCGC
CTGCCGGAAGCCAGCACCCTGCGGACCCAGCGGCGGAACGAGAGGCGCAAGACGCAGACGGCCATCCGCAACTGG
ATGGACCAGAACGACGACGCCGGCATGCCCCTGTCCAACTGGCCGACGCTGGAGAGCCGGGCGGTGCCGGACTGG
CATAGGCGGCTGAGCGTCGGCTGGGAGCGCTCGTCCCACCTCCGACACGTCTCCGACGTCAGGTCGACGGCGAGC
GACCCGGCCGACTTCGTGTCGAACCACGAGGCGCCCCATGGACGCGGGCCCGGATCGCGGCGGCCGAACGTGGCG
GCGCTCGACTACAAGGACCAGACCGACGCGGACGCGGACGGCGACGACGAGCTGGTGACAAACGACGAGGACGAG
GACGACGCGGGGACGAATGCGGACCGCAGCCACCAGTACGAAAAGCTCGGGGTGGAGGAGGAGGACTACTTCACG
ACGCCGATCCCGACGCGCTCGGCCAAGCTGCCGACGTCTCACCCGTCGCCGGTGCAGAACGCCGCGTCGCTCGCC
CCTCAACCGATCCTGCAGAGGCGCGGGGGCCACAGCCGGTCGGTGTCGACCAACACGATACTGTACAAGCCGGAG
GAGCTGCCGCGGGTGTACAGCTCCTCGTCGTCCAGGTCGCCGCCGCAGGCCGGGCCGGGGCGAAAGGCCGGGCCG
AGCGGGCGCAACACGGGGGCGAACACGCCGGCGGCGGCGGGGCGGCGCAGCTCGCCGCGACGGCCGGTGGTGCTC
TTGCCGAGCTCGCAGCCTCGGCCGATCCTGGCGCCGCGCGGGCTGACGGAGACGGGAGGCGTCAGCCGGACGGCC
ATGCTCAGCCTGGACCCTCACGACCGGCTGCGACAGGCCAGGAGACTGTCGTCGGTGGACCTGAGCGTGCTCTCG
GACAACTTCGGGGCGGACGACCCGATCGCGGGCATGGCCGGAAGCTTCCAGACGCAGATGGCCATGGCCATGATG
AAGGACAACCGGCTCCGGGTGGCGGGGGGCATCGACGTGGCCGACCGGGACAGGATGGGCCGACTGGTGCTGGCG
CGGATGAAGACGCTGGAGGAGAGCTTCGCGGACGTGATCAAGGAGATGCGGGACCTCAAGAACAGCTCGACGGCG
CCGCAGTCGCAGAGGAACTCGTCGGGCGAGGAGCTGAAAGGGGCGACGGCCGACACAAGCGGGCAGGAACGTGCC
AAGAGAGCGGCGGGCAAGGGGGACGCGACGCCAAAGAAGGGCTACGGCAAGAGGCCGGTGAGCCGGCGGAGCATG
CGGGAGGGCAAGGTGGGCATGCTGGCGCGGCCAGACTTGAAGGGCAAGGGCAAGGAGGTGAGGTACTCGACGACG
GACGACGAGGCGGAAGCCGAGGGAAGTCTGGCCTTGAGGGGGAGCTCGATGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail