Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7812
Gene name
LocationContig_477:906..2278
Strand-
Gene length (bp)1372
Transcript length (bp)1011
Coding sequence length (bp)1011
Protein length (aa) 337

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02453 Reticulon Reticulon 7.7E-35 79 236

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53694|RTN1_SCHPO Reticulon-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rtn1 PE=1 SV=1 81 254 1.0E-12
sp|Q04947|RTN1_YEAST Reticulon-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTN1 PE=1 SV=1 80 332 4.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

Domain # Start End Length
1 92 114 22
2 118 140 22
3 177 199 22
4 203 225 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7812
MSDALDTAPTANGGGAFEAAKANAASAYDAVTNGPVAQNVKDHSAKASSELSTLAASRKTPSNPAATGQPLTHYH
SFFSELLSWNNPRASAIAYASAITFIFAARYLDVVRWAFKLCWMALAVTVSAEAAGKVVLNHGLATQMRPRRYYT
ISRSTLDNMIGDVHELANFFVIEAQRILFAENVAASAAACVAAFLSYHLAKLVPYWGLAIIATTIAFFAPLVYTS
NQELIDHHIKNASDVISAQTAQVRTAAQKQAGQLTTMGKQYAGDYTGKVQEMIRGRSASPEAATKPAPSHKGLEF
PTPPTEEPKKVVEPQGPIPVDPVEPVVPEQEPMIAS*
Coding >Hirsu2|7812
ATGTCTGACGCCCTCGATACGGCCCCGACGGCCAATGGTGGCGGTGCTTTCGAGGCCGCCAAGGCCAACGCCGCC
TCTGCCTACGATGCCGTGACCAACGGCCCCGTTGCGCAAAACGTCAAGGACCACTCCGCCAAGGCATCGTCCGAG
CTGTCCACCCTGGCAGCTTCCCGCAAGACGCCGTCCAACCCGGCCGCCACCGGACAGCCTCTGACACACTATCAC
TCCTTTTTCTCGGAGCTCTTGTCGTGGAACAATCCCCGCGCCTCCGCCATCGCTTATGCCTCCGCCATCACCTTC
ATCTTCGCGGCTAGGTACCTCGACGTGGTCCGTTGGGCGTTTAAGCTGTGCTGGATGGCGCTCGCCGTCACCGTC
AGCGCCGAGGCTGCCGGCAAGGTCGTCTTGAACCACGGGCTTGCCACGCAGATGCGGCCCCGTCGATACTACACC
ATCTCGCGGTCGACTCTGGACAACATGATCGGCGATGTCCACGAGCTGGCCAACTTCTTCGTCATCGAGGCTCAG
CGCATCCTCTTCGCCGAGAACGTCGCCGCCTCTGCCGCCGCCTGCGTTGCCGCCTTCCTCTCGTACCATCTCGCC
AAGCTGGTCCCGTACTGGGGTCTCGCCATCATCGCCACCACGATCGCCTTCTTCGCCCCCCTCGTCTACACGTCG
AACCAGGAGCTCATTGACCACCACATCAAGAATGCCTCCGACGTCATCAGCGCCCAGACGGCCCAGGTCCGAACT
GCCGCCCAGAAGCAGGCCGGCCAGCTCACCACCATGGGCAAGCAGTACGCTGGCGACTACACCGGCAAGGTCCAG
GAGATGATCCGCGGCCGCAGCGCTTCCCCCGAGGCCGCGACCAAGCCGGCACCCTCCCACAAGGGCCTCGAGTTT
CCCACCCCCCCGACCGAGGAGCCGAAGAAGGTGGTGGAGCCCCAGGGCCCGATTCCCGTGGACCCCGTTGAGCCC
GTTGTGCCTGAGCAGGAGCCCATGATTGCTTCCTAG
Transcript >Hirsu2|7812
ATGTCTGACGCCCTCGATACGGCCCCGACGGCCAATGGTGGCGGTGCTTTCGAGGCCGCCAAGGCCAACGCCGCC
TCTGCCTACGATGCCGTGACCAACGGCCCCGTTGCGCAAAACGTCAAGGACCACTCCGCCAAGGCATCGTCCGAG
CTGTCCACCCTGGCAGCTTCCCGCAAGACGCCGTCCAACCCGGCCGCCACCGGACAGCCTCTGACACACTATCAC
TCCTTTTTCTCGGAGCTCTTGTCGTGGAACAATCCCCGCGCCTCCGCCATCGCTTATGCCTCCGCCATCACCTTC
ATCTTCGCGGCTAGGTACCTCGACGTGGTCCGTTGGGCGTTTAAGCTGTGCTGGATGGCGCTCGCCGTCACCGTC
AGCGCCGAGGCTGCCGGCAAGGTCGTCTTGAACCACGGGCTTGCCACGCAGATGCGGCCCCGTCGATACTACACC
ATCTCGCGGTCGACTCTGGACAACATGATCGGCGATGTCCACGAGCTGGCCAACTTCTTCGTCATCGAGGCTCAG
CGCATCCTCTTCGCCGAGAACGTCGCCGCCTCTGCCGCCGCCTGCGTTGCCGCCTTCCTCTCGTACCATCTCGCC
AAGCTGGTCCCGTACTGGGGTCTCGCCATCATCGCCACCACGATCGCCTTCTTCGCCCCCCTCGTCTACACGTCG
AACCAGGAGCTCATTGACCACCACATCAAGAATGCCTCCGACGTCATCAGCGCCCAGACGGCCCAGGTCCGAACT
GCCGCCCAGAAGCAGGCCGGCCAGCTCACCACCATGGGCAAGCAGTACGCTGGCGACTACACCGGCAAGGTCCAG
GAGATGATCCGCGGCCGCAGCGCTTCCCCCGAGGCCGCGACCAAGCCGGCACCCTCCCACAAGGGCCTCGAGTTT
CCCACCCCCCCGACCGAGGAGCCGAAGAAGGTGGTGGAGCCCCAGGGCCCGATTCCCGTGGACCCCGTTGAGCCC
GTTGTGCCTGAGCAGGAGCCCATGATTGCTTCCTAG
Gene >Hirsu2|7812
ATGTCTGACGCCCTCGATACGGCCCCGACGGCCAATGGTGGCGGTGCTTTCGAGGCCGCCAAGGCCAGTGAGGTA
AGCTCCAGCCCTTGATCATATTTTTTTTTATTCGTCCCATCTTCTCTTTGGACGAGGCCAAGCTCGCTAACTGTT
GGACCAGTTTGCCCATCGTGCTTCCCTTGATTCGTGCCCGACCCTGGCGAAGAGCTCACAAATTTTCTACCAGAC
GCCGCCTCTGCCTACGATGCCGTGACCAACGGTGAGCCCTGCCATCCCTCCCCCTTTCTGCCAGCTGTGACTGAC
TCTGCCTGCCTCTCTGCTTTCTTCAGGCCCCGTTGCGCAAAACGTCAAGGACCACTCCGCCAAGGCATCGTCCGA
GCTGTCCACCCTGGCAGCTTCCCGCAAGACGCCGTCCAACCCGGCCGCCACCGGACAGCCTCTGACACACTATCA
CTCCTTTTTCTCGGAGCTCTTGTCGTGGAACAATCCCCGTGCGTCTACTGTCTCGTCCCTCCCCGACCTCTTGTG
CTTCGCTCGGATGCTGACCGCGGCGGCATCGCCAGGCGCCTCCGCCATCGCTTATGCCTCCGCCATCACCTTCAT
CTTCGCGGCTAGGTACCTCGACGTGGTCCGTTGGGCGTTTAAGCTGTGCTGGATGGCGCTCGCCGTCACCGTCAG
CGCCGAGGCTGCCGGCAAGGTCGTCTTGAACCACGGGCTTGCCACGCAGATGCGGCCCCGTCGATACTACACCAT
CTCGCGGTCGACTCTGGACAACATGATCGGCGATGTCCACGAGCTGGCCAACTTCTTCGTCATCGAGGCTCAGCG
CATCCTCTTCGCCGAGAACGTCGCCGCCTCTGCCGCCGTAAGATGGGCCTTGGCACTACACCGCACTGGCGTGGC
GTCGGCTGGCTAACGGACGTTGCAGGCCTGCGTTGCCGCCTTCCTCTCGTACCATCTCGCCAAGCTGGTCCCGTA
CTGGGGTCTCGCCATCATCGCCACCACGATCGCCTTCTTCGCCCCCCTCGTCTACACGTCGAACCAGGAGCTCAT
TGACCACCACATCAAGAATGCCTCCGACGTCATCAGCGCCCAGACGGCCCAGGTCCGAACTGCCGCCCAGAAGCA
GGCCGGCCAGCTCACCACCATGGGCAAGCAGTACGCTGGCGACTACACCGGCAAGGTCCAGGAGATGATCCGCGG
CCGCAGCGCTTCCCCCGAGGCCGCGACCAAGCCGGCACCCTCCCACAAGGGCCTCGAGTTTCCCACCCCCCCGAC
CGAGGAGCCGAAGAAGGTGGTGGAGCCCCAGGGCCCGATTCCCGTGGACCCCGTTGAGCCCGTTGTGCCTGAGCA
GGAGCCCATGATTGCTTCCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail