© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|7811 |
| Gene name | |
| Location | Contig_476:17136..17595 |
| Strand | - |
| Gene length (bp) | 459 |
| Transcript length (bp) | 327 |
| Coding sequence length (bp) | 327 |
| Protein length (aa) | 109 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF09446 | VMA21 | VMA21-like domain | 9.8E-15 | 34 | 89 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q7S158|VMA21_NEUCR | Vacuolar ATPase assembly integral membrane protein vma-21 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vma-21 PE=3 SV=1 | 1 | 96 | 3.0E-39 |
| sp|Q2HDV5|VMA21_CHAGB | Vacuolar ATPase assembly integral membrane protein VMA21 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=VMA21 PE=3 SV=1 | 1 | 96 | 1.0E-38 |
| sp|A4R0J5|VMA21_MAGO7 | Vacuolar ATPase assembly integral membrane protein VMA21 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=VMA21 PE=3 SV=1 | 1 | 108 | 2.0E-35 |
| sp|B2WDD8|VMA21_PYRTR | Vacuolar ATPase assembly integral membrane protein vma21 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=vma21 PE=3 SV=1 | 1 | 105 | 5.0E-35 |
| sp|A7F5K4|VMA21_SCLS1 | Vacuolar ATPase assembly integral membrane protein vma21 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=vma21 PE=3 SV=1 | 10 | 107 | 6.0E-34 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q7S158|VMA21_NEUCR | Vacuolar ATPase assembly integral membrane protein vma-21 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vma-21 PE=3 SV=1 | 1 | 96 | 3.0E-39 |
| sp|Q2HDV5|VMA21_CHAGB | Vacuolar ATPase assembly integral membrane protein VMA21 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=VMA21 PE=3 SV=1 | 1 | 96 | 1.0E-38 |
| sp|A4R0J5|VMA21_MAGO7 | Vacuolar ATPase assembly integral membrane protein VMA21 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=VMA21 PE=3 SV=1 | 1 | 108 | 2.0E-35 |
| sp|B2WDD8|VMA21_PYRTR | Vacuolar ATPase assembly integral membrane protein vma21 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=vma21 PE=3 SV=1 | 1 | 105 | 5.0E-35 |
| sp|A7F5K4|VMA21_SCLS1 | Vacuolar ATPase assembly integral membrane protein vma21 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=vma21 PE=3 SV=1 | 10 | 107 | 6.0E-34 |
| sp|Q0UV26|VMA21_PHANO | Vacuolar ATPase assembly integral membrane protein VMA21 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=VMA21 PE=3 SV=1 | 1 | 107 | 8.0E-33 |
| sp|A1CJW1|VMA21_ASPCL | Vacuolar ATPase assembly integral membrane protein vma21 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=vma21 PE=3 SV=1 | 23 | 106 | 2.0E-23 |
| sp|Q5B905|VMA21_EMENI | Vacuolar ATPase assembly integral membrane protein vma21 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=vma21 PE=3 SV=2 | 1 | 98 | 1.0E-21 |
| sp|Q0CXF5|VMA21_ASPTN | Vacuolar ATPase assembly integral membrane protein vma21 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=vma21 PE=3 SV=1 | 1 | 98 | 2.0E-19 |
| sp|Q4WX68|VMA21_ASPFU | Vacuolar ATPase assembly integral membrane protein vma21 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=vma21 PE=3 SV=1 | 25 | 106 | 1.0E-18 |
| sp|B0XYF0|VMA21_ASPFC | Vacuolar ATPase assembly integral membrane protein vma21 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=vma21 PE=3 SV=1 | 25 | 106 | 1.0E-18 |
| sp|Q1DPX9|VMA21_COCIM | Vacuolar ATPase assembly integral membrane protein VMA21 OS=Coccidioides immitis (strain RS) GN=VMA21 PE=3 SV=1 | 29 | 106 | 2.0E-18 |
| sp|A1D7K7|VMA21_NEOFI | Vacuolar ATPase assembly integral membrane protein vma21 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=vma21 PE=3 SV=1 | 24 | 96 | 2.0E-18 |
| sp|A6R3V7|VMA21_AJECN | Vacuolar ATPase assembly integral membrane protein VMA21 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=VMA21 PE=3 SV=1 | 1 | 108 | 2.0E-17 |
| sp|A3LU53|VMA21_PICST | Vacuolar ATPase assembly integral membrane protein VMA21 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=VMA21 PE=3 SV=2 | 31 | 107 | 6.0E-16 |
| sp|Q6BXM0|VMA21_DEBHA | Vacuolar ATPase assembly integral membrane protein VMA21 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=VMA21 PE=3 SV=1 | 31 | 108 | 1.0E-14 |
| sp|P41806|VMA21_YEAST | Vacuolar ATPase assembly integral membrane protein VMA21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA21 PE=1 SV=1 | 31 | 96 | 1.0E-12 |
| sp|A6ZV87|VMA21_YEAS7 | Vacuolar ATPase assembly integral membrane protein VMA21 OS=Saccharomyces cerevisiae (strain YJM789) GN=VMA21 PE=3 SV=1 | 31 | 96 | 1.0E-12 |
| sp|B3LIC1|VMA21_YEAS1 | Vacuolar ATPase assembly integral membrane protein VMA21 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=VMA21 PE=3 SV=1 | 31 | 96 | 1.0E-12 |
| sp|B4UN04|VMA21_CANGA | Vacuolar ATPase assembly integral membrane protein VMA21 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=VMA21 PE=3 SV=1 | 31 | 107 | 1.0E-12 |
| sp|Q6CDK3|VMA21_YARLI | Vacuolar ATPase assembly integral membrane protein VMA21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=VMA21 PE=3 SV=1 | 31 | 92 | 5.0E-12 |
| sp|C6Y4C8|VMA21_SCHPO | Vacuolar ATPase assembly integral membrane protein vma21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vma21 PE=3 SV=1 | 20 | 92 | 8.0E-12 |
| sp|Q75EI3|VMA21_ASHGO | Vacuolar ATPase assembly integral membrane protein VMA21 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VMA21 PE=3 SV=1 | 31 | 108 | 5.0E-11 |
| sp|A5DGY3|VMA21_PICGU | Vacuolar ATPase assembly integral membrane protein VMA21 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=VMA21 PE=3 SV=1 | 33 | 103 | 4.0E-09 |
| sp|Q6CQP9|VMA21_KLULA | Vacuolar ATPase assembly integral membrane protein VMA21 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=VMA21 PE=3 SV=2 | 31 | 108 | 6.0E-09 |
| sp|P0CS24|VMA21_CRYNJ | Vacuolar ATPase assembly integral membrane protein VMA21 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=VMA21 PE=3 SV=1 | 24 | 105 | 2.0E-07 |
| sp|P0CS25|VMA21_CRYNB | Vacuolar ATPase assembly integral membrane protein VMA21 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=VMA21 PE=3 SV=1 | 24 | 105 | 2.0E-07 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0070072 | vacuolar proton-transporting V-type ATPase complex assembly | Yes |
| GO:0016043 | cellular component organization | No |
| GO:0071840 | cellular component organization or biogenesis | No |
| GO:0009987 | cellular process | No |
| GO:0043933 | protein-containing complex organization | No |
| GO:0065003 | protein-containing complex assembly | No |
| GO:0022607 | cellular component assembly | No |
| GO:0070070 | proton-transporting V-type ATPase complex assembly | No |
| GO:0008150 | biological_process | No |
| GO:0070071 | proton-transporting two-sector ATPase complex assembly | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 40 | 0.5 |
| Domain # | Start | End | Length |
|---|---|---|---|
| 1 | 36 | 58 | 22 |
| 2 | 68 | 90 | 22 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|7811 MATRRIISSEKTILEKDDGQTGDKSDISPAVPRHVIYKLLGFTAAMIVLPIGSYFLAVDTIFKGNSSYAGAMAAL LANVILIAYVVVAMNEDQSERTAADKPESKKDR* |
| Coding | >Hirsu2|7811 ATGGCGACACGACGGATCATCAGCTCCGAGAAGACGATCCTGGAGAAGGACGACGGCCAGACGGGGGACAAGTCC GACATTAGCCCAGCCGTGCCCAGACATGTCATCTACAAACTCCTGGGGTTCACCGCGGCCATGATCGTCCTCCCC ATTGGCTCCTACTTCCTCGCCGTCGATACCATCTTCAAAGGCAACTCGTCGTACGCGGGAGCCATGGCCGCCCTT CTAGCAAACGTCATCCTCATCGCCTACGTCGTCGTGGCCATGAACGAGGATCAGTCTGAAAGGACGGCAGCGGAC AAGCCGGAAAGCAAGAAAGATCGGTAA |
| Transcript | >Hirsu2|7811 ATGGCGACACGACGGATCATCAGCTCCGAGAAGACGATCCTGGAGAAGGACGACGGCCAGACGGGGGACAAGTCC GACATTAGCCCAGCCGTGCCCAGACATGTCATCTACAAACTCCTGGGGTTCACCGCGGCCATGATCGTCCTCCCC ATTGGCTCCTACTTCCTCGCCGTCGATACCATCTTCAAAGGCAACTCGTCGTACGCGGGAGCCATGGCCGCCCTT CTAGCAAACGTCATCCTCATCGCCTACGTCGTCGTGGCCATGAACGAGGATCAGTCTGAAAGGACGGCAGCGGAC AAGCCGGAAAGCAAGAAAGATCGGTAA |
| Gene | >Hirsu2|7811 ATGGCGACACGACGGATCATCAGCTCCGAGAAGACGATCCTGGAGAAGGACGACGGCCAGACGGGGGACAAGTCC GACATTAGCCCAGCCGTGCCCAGGTGAGAGCGACAGAGGGAGAGAGAGACAGTGAAGCCCGTCCCGTGCGCCTGG CCCTGACCAAGACCCGCTTGCCTTCAGACATGTCATCTACAAACTCCTGGGGTTCACCGCGGCCATGATCGTCCT CCCCATTGGCTCCTACTTCCTCGCCGTCGATACCATCTTCAAAGGCACGTTTCCCCTCTTCGCAGCCAGGCATCC TGGATTGCTAATCCGTCTCTAGGCAACTCGTCGTACGCGGGAGCCATGGCCGCCCTTCTAGCAAACGTCATCCTC ATCGCCTACGTCGTCGTGGCCATGAACGAGGATCAGTCTGAAAGGACGGCAGCGGACAAGCCGGAAAGCAAGAAA GATCGGTAA |