Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|781
Gene name
LocationContig_1160:4788..6899
Strand+
Gene length (bp)2111
Transcript length (bp)1989
Coding sequence length (bp)1989
Protein length (aa) 663

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00856 SET SET domain 3.5E-07 278 457

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.7143 0.7971 0.1363 0.0467 0.075 0.042 0.0736 0.0474 0.031 0.0137

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6750
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|02763
Ophiocordyceps camponoti-rufipedis Ophun1|1193
Ophiocordyceps kimflemingae Ophio5|2895
Ophiocordyceps subramaniannii Hirsu2|781 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|781
MISDMKLETHHRGKRTLLRVCTPANRMTAVMAIVEDQQGTAVLLQLYHQPEEADVPADDILWPGLVFIVKEPFFK
CASDGSYSIRVDHPSDIIWLGEDDEYVPMNWRRATVQSESSPDYRTRGNEAVKNEKWAEAHALYSSAIRSARTAE
EERLAYMNRSLANLKLGRPEQALSDAVRIRDAVSDAEQEKRLFREGRALYELERFEACRDTLEDLLKLFPHNAAA
NKELDRAQARLREQQTGEYDFRRMYRQSKATPPLVDCATFSSAVEVRASPGRGLGLFTKTPVSAGQLLLCEKAFA
YSHCGDDSTRVLMNLCTKRMTAGSQAHLFTQVVQKLYHNPERSRPFRQLHRGAYAADTVLECDELPVVDSFLVER
IISLNSFGAPRTSLAFVSNEMSPDHDKKDPSTRTHTTTGVWLVASRINHSCVGNCRRSFIGDMQIVRATRDMPAD
TELQFAYQHLRKHQSYKEAQKQLDNWGFVCNCPLCQMRKVTTEQALQRRKALDESLSKVLSGPLGTNVVRSQQIL
LEMAETYPSPEADAIRLELWDPYFAMGEQLVCSDRPAEAIQMIVKGLEALGYSITARPPMGSDKKPKLEVKRWGQ
PNDWTPHAFMNLLRAYKTLAPKLCPAAKAYVVTAYSMVVGEGATVRDTFPDFERRVRFLLVD*
Coding >Hirsu2|781
ATGATCTCGGACATGAAGCTGGAAACGCACCATCGCGGCAAGAGGACCCTGCTGCGTGTTTGCACGCCGGCAAAC
CGCATGACAGCCGTCATGGCAATTGTCGAGGACCAGCAAGGCACTGCTGTCTTGCTCCAGCTATACCACCAGCCA
GAGGAAGCAGACGTGCCGGCGGATGACATTCTGTGGCCTGGTCTCGTCTTCATCGTGAAGGAGCCGTTCTTCAAA
TGCGCCAGCGACGGCTCGTACTCGATCAGAGTGGACCACCCCAGCGACATCATCTGGCTCGGGGAAGACGACGAG
TATGTCCCAATGAATTGGAGACGAGCCACGGTGCAATCCGAAAGCAGTCCCGACTACCGCACCCGGGGTAACGAG
GCTGTCAAGAATGAGAAATGGGCCGAGGCTCATGCTTTATACTCGTCCGCCATCCGATCTGCCCGGACGGCCGAG
GAGGAGCGGCTGGCCTATATGAACCGCTCGCTGGCAAACCTCAAGCTCGGGCGTCCGGAGCAGGCCTTGTCGGAC
GCCGTCCGCATCAGGGACGCCGTATCGGATGCGGAACAAGAGAAGCGGCTGTTTCGTGAAGGCCGGGCCCTGTAC
GAGCTGGAGAGATTCGAGGCTTGCCGAGACACTCTCGAGGACCTGCTCAAGCTGTTCCCACACAACGCGGCCGCC
AATAAAGAACTGGACCGCGCCCAGGCGAGGCTGCGCGAGCAGCAGACGGGCGAGTATGATTTCCGCCGGATGTAC
CGGCAGAGCAAAGCGACTCCGCCGCTGGTCGACTGCGCTACATTCTCGTCCGCCGTCGAGGTGCGCGCCTCCCCT
GGGCGAGGCCTCGGACTCTTCACGAAGACGCCGGTCTCGGCAGGCCAGCTTTTGCTATGCGAGAAGGCATTTGCT
TATTCTCATTGCGGCGACGACTCCACGAGGGTTCTCATGAACTTGTGCACCAAGAGGATGACGGCAGGCAGCCAG
GCTCACCTCTTCACCCAAGTTGTGCAGAAGCTGTATCATAACCCCGAGCGGTCGCGTCCTTTCAGGCAGTTACAC
CGCGGCGCATACGCGGCGGATACGGTGTTGGAATGTGATGAACTACCAGTTGTCGATTCTTTCTTAGTTGAGAGA
ATCATCAGCCTGAACTCGTTTGGCGCTCCGCGGACGAGCCTCGCCTTTGTCTCGAACGAAATGTCACCGGATCAC
GATAAGAAAGACCCAAGCACAAGAACCCATACCACTACGGGCGTCTGGCTGGTCGCCTCGCGCATCAACCATTCC
TGTGTCGGCAACTGCCGCCGTTCCTTCATCGGCGACATGCAGATTGTGCGCGCAACGCGGGACATGCCAGCAGAC
ACGGAGCTTCAGTTCGCCTATCAGCACCTGCGCAAGCACCAGTCCTACAAGGAAGCGCAGAAGCAGCTCGACAAC
TGGGGCTTCGTCTGCAACTGCCCGCTGTGCCAGATGAGGAAGGTCACGACGGAGCAGGCGCTGCAGAGGCGCAAG
GCCCTGGATGAAAGCCTCTCGAAAGTGTTGAGCGGCCCGCTCGGCACCAACGTTGTTCGGTCGCAGCAAATCCTG
CTGGAAATGGCCGAGACGTACCCTTCGCCAGAGGCCGACGCCATCCGGCTGGAGCTCTGGGATCCGTACTTTGCG
ATGGGCGAGCAGCTTGTCTGCTCTGATAGGCCAGCCGAGGCCATCCAGATGATAGTCAAGGGCCTCGAGGCGCTG
GGATACAGCATCACGGCACGCCCGCCGATGGGAAGCGACAAGAAGCCCAAACTCGAGGTCAAGCGCTGGGGTCAG
CCGAACGATTGGACGCCCCATGCGTTTATGAACCTGCTCCGAGCTTACAAGACGCTTGCGCCCAAGCTGTGCCCT
GCTGCCAAGGCATATGTCGTGACGGCGTACAGCATGGTCGTGGGCGAGGGGGCTACAGTCAGGGATACGTTTCCG
GATTTTGAGAGAAGGGTGAGGTTTTTGCTGGTGGACTAG
Transcript >Hirsu2|781
ATGATCTCGGACATGAAGCTGGAAACGCACCATCGCGGCAAGAGGACCCTGCTGCGTGTTTGCACGCCGGCAAAC
CGCATGACAGCCGTCATGGCAATTGTCGAGGACCAGCAAGGCACTGCTGTCTTGCTCCAGCTATACCACCAGCCA
GAGGAAGCAGACGTGCCGGCGGATGACATTCTGTGGCCTGGTCTCGTCTTCATCGTGAAGGAGCCGTTCTTCAAA
TGCGCCAGCGACGGCTCGTACTCGATCAGAGTGGACCACCCCAGCGACATCATCTGGCTCGGGGAAGACGACGAG
TATGTCCCAATGAATTGGAGACGAGCCACGGTGCAATCCGAAAGCAGTCCCGACTACCGCACCCGGGGTAACGAG
GCTGTCAAGAATGAGAAATGGGCCGAGGCTCATGCTTTATACTCGTCCGCCATCCGATCTGCCCGGACGGCCGAG
GAGGAGCGGCTGGCCTATATGAACCGCTCGCTGGCAAACCTCAAGCTCGGGCGTCCGGAGCAGGCCTTGTCGGAC
GCCGTCCGCATCAGGGACGCCGTATCGGATGCGGAACAAGAGAAGCGGCTGTTTCGTGAAGGCCGGGCCCTGTAC
GAGCTGGAGAGATTCGAGGCTTGCCGAGACACTCTCGAGGACCTGCTCAAGCTGTTCCCACACAACGCGGCCGCC
AATAAAGAACTGGACCGCGCCCAGGCGAGGCTGCGCGAGCAGCAGACGGGCGAGTATGATTTCCGCCGGATGTAC
CGGCAGAGCAAAGCGACTCCGCCGCTGGTCGACTGCGCTACATTCTCGTCCGCCGTCGAGGTGCGCGCCTCCCCT
GGGCGAGGCCTCGGACTCTTCACGAAGACGCCGGTCTCGGCAGGCCAGCTTTTGCTATGCGAGAAGGCATTTGCT
TATTCTCATTGCGGCGACGACTCCACGAGGGTTCTCATGAACTTGTGCACCAAGAGGATGACGGCAGGCAGCCAG
GCTCACCTCTTCACCCAAGTTGTGCAGAAGCTGTATCATAACCCCGAGCGGTCGCGTCCTTTCAGGCAGTTACAC
CGCGGCGCATACGCGGCGGATACGGTGTTGGAATGTGATGAACTACCAGTTGTCGATTCTTTCTTAGTTGAGAGA
ATCATCAGCCTGAACTCGTTTGGCGCTCCGCGGACGAGCCTCGCCTTTGTCTCGAACGAAATGTCACCGGATCAC
GATAAGAAAGACCCAAGCACAAGAACCCATACCACTACGGGCGTCTGGCTGGTCGCCTCGCGCATCAACCATTCC
TGTGTCGGCAACTGCCGCCGTTCCTTCATCGGCGACATGCAGATTGTGCGCGCAACGCGGGACATGCCAGCAGAC
ACGGAGCTTCAGTTCGCCTATCAGCACCTGCGCAAGCACCAGTCCTACAAGGAAGCGCAGAAGCAGCTCGACAAC
TGGGGCTTCGTCTGCAACTGCCCGCTGTGCCAGATGAGGAAGGTCACGACGGAGCAGGCGCTGCAGAGGCGCAAG
GCCCTGGATGAAAGCCTCTCGAAAGTGTTGAGCGGCCCGCTCGGCACCAACGTTGTTCGGTCGCAGCAAATCCTG
CTGGAAATGGCCGAGACGTACCCTTCGCCAGAGGCCGACGCCATCCGGCTGGAGCTCTGGGATCCGTACTTTGCG
ATGGGCGAGCAGCTTGTCTGCTCTGATAGGCCAGCCGAGGCCATCCAGATGATAGTCAAGGGCCTCGAGGCGCTG
GGATACAGCATCACGGCACGCCCGCCGATGGGAAGCGACAAGAAGCCCAAACTCGAGGTCAAGCGCTGGGGTCAG
CCGAACGATTGGACGCCCCATGCGTTTATGAACCTGCTCCGAGCTTACAAGACGCTTGCGCCCAAGCTGTGCCCT
GCTGCCAAGGCATATGTCGTGACGGCGTACAGCATGGTCGTGGGCGAGGGGGCTACAGTCAGGGATACGTTTCCG
GATTTTGAGAGAAGGGTGAGGTTTTTGCTGGTGGACTAG
Gene >Hirsu2|781
ATGATCTCGGACATGAAGCTGGAAACGCACCATCGCGGCAAGAGGACCCTGCTGCGTGTTTGCACGCCGGCAAAC
CGCATGACAGCCGTCATGGCAATTGTCGAGGACCAGCAAGGCACTGCTGTCTTGCTCCAGCTATACCACCAGCCA
GAGGAAGCAGACGTGCCGGCGGATGACATTCTGTGGCCTGGTCTCGTCTTCATCGTGAAGGAGCCGTTCTTCAAA
TGCGCCAGCGACGGCTCGTACTCGATCAGAGTGGACCACCCCAGCGACATCATCTGGCTCGGGGAAGACGACGAG
TATGTCCCAATGAATTGGAGACGAGCCACGGTGCAATCCGAAAGCAGTCCCGACTACCGCACCCGGGGTAACGAG
GCTGTCAAGAATGAGAAATGGGCCGAGGCTCATGCTTTGTACGCCTTTCCCTCACAACTTGTTGGTGCTGAGTCC
AGCATGTCCGCTAAGCGCCTCGACTGCCAGATACTCGTCCGCCATCCGATCTGCCCGGACGGCCGAGGAGGAGCG
GCTGGCCTATATGAACCGCTCGCTGGCAAACCTCAAGCTCGGGCGTCCGGAGCAGGCCTTGTCGGACGCCGTCCG
CATCAGGGACGCCGTATCGGATGCGGAACAAGAGAAGCGGCTGTTTCGTGAAGGCCGGGCCCTGTACGAGCTGGA
GAGATTCGAGGCTTGCCGAGACACTCTCGAGGACCTGCTCAAGCTGTTCCCACACAACGCGGCCGCCAATAAAGA
ACTGGACCGCGCCCAGGCGAGGCTGCGCGAGCAGCAGACGGGCGAGTATGATTTCCGCCGGATGTACCGGCAGAG
CAAAGCGACTCCGCCGCTGGTCGACTGCGCTACATTCTCGTCCGCCGTCGAGGTGCGCGCCTCCCCTGGGCGAGG
CCTCGGACTCTTCACGAAGACGCCGGTCTCGGCAGGCCAGCTTTTGCTATGCGAGAAGGCATTTGCTTATTCTCA
TTGCGGCGACGACTCCACGAGGGTTCTCATGAACTTGTGCACCAAGAGGATGACGGCAGGCAGCCAGGCTCACCT
CTTCACCCAAGTTGTGCAGAAGCTGTATCATAACCCCGAGCGGTCGCGTCCTTTCAGGCAGTTACACCGCGGCGC
ATACGCGGCGGATACGGTGTTGGAATGTGATGAACTACCAGTTGTCGATTCGTGCGTGAGAAGTCAAGGCGCCAG
CGCAGAGAACAGCGACTGACTTTGGGTCTAGTTTCTTAGTTGAGAGAATCATCAGCCTGAACTCGTTTGGCGCTC
CGCGGACGAGCCTCGCCTTTGTCTCGAACGAAATGTCACCGGATCACGATAAGAAAGACCCAAGCACAAGAACCC
ATACCACTACGGGCGTCTGGCTGGTCGCCTCGCGCATCAACCATTCCTGTGTCGGCAACTGCCGCCGTTCCTTCA
TCGGCGACATGCAGATTGTGCGCGCAACGCGGGACATGCCAGCAGACACGGAGCTTCAGTTCGCCTATCAGCACC
TGCGCAAGCACCAGTCCTACAAGGAAGCGCAGAAGCAGCTCGACAACTGGGGCTTCGTCTGCAACTGCCCGCTGT
GCCAGATGAGGAAGGTCACGACGGAGCAGGCGCTGCAGAGGCGCAAGGCCCTGGATGAAAGCCTCTCGAAAGTGT
TGAGCGGCCCGCTCGGCACCAACGTTGTTCGGTCGCAGCAAATCCTGCTGGAAATGGCCGAGACGTACCCTTCGC
CAGAGGCCGACGCCATCCGGCTGGAGCTCTGGGATCCGTACTTTGCGATGGGCGAGCAGCTTGTCTGCTCTGATA
GGCCAGCCGAGGCCATCCAGATGATAGTCAAGGGCCTCGAGGCGCTGGGATACAGCATCACGGCACGCCCGCCGA
TGGGAAGCGACAAGAAGCCCAAACTCGAGGTCAAGCGCTGGGGTCAGCCGAACGATTGGACGCCCCATGCGTTTA
TGAACCTGCTCCGAGCTTACAAGACGCTTGCGCCCAAGCTGTGCCCTGCTGCCAAGGCATATGTCGTGACGGCGT
ACAGCATGGTCGTGGGCGAGGGGGCTACAGTCAGGGATACGTTTCCGGATTTTGAGAGAAGGGTGAGGTTTTTGC
TGGTGGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail