Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7809
Gene name
LocationContig_476:12424..13657
Strand+
Gene length (bp)1233
Transcript length (bp)510
Coding sequence length (bp)510
Protein length (aa) 170

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 3.7E-11 6 47

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P36136|SHB17_YEAST Sedoheptulose 1,7-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHB17 PE=1 SV=1 1 63 7.0E-11
sp|O07617|PHOE_BACSU Uncharacterized phosphatase PhoE OS=Bacillus subtilis (strain 168) GN=phoE PE=3 SV=1 6 45 5.0E-08
sp|A8G9J4|GPMB_SERP5 Probable phosphoglycerate mutase GpmB OS=Serratia proteamaculans (strain 568) GN=gpmB PE=3 SV=1 5 43 9.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7809
MPSPRVFLVRHGETEWSLSGKHTGRTDIPLTADGEKRVRATGQALVGNDRLIVPRKLSHMTDSAAFHSSPPTNGG
PTRPSPVEPGHKPPLHRPVPSSTTIPSLVRVGSVDQAADDDDDDDDDDDSPSLCPCRTPVRQLSLASPPASEARP
FFLSHAIAVQTTAGRDTAC*
Coding >Hirsu2|7809
ATGCCGTCCCCGCGCGTCTTCCTCGTCCGCCACGGCGAGACGGAGTGGTCCCTCAGCGGCAAGCACACTGGCCGC
ACCGACATCCCCCTCACGGCCGACGGCGAGAAGCGCGTGCGAGCCACGGGCCAGGCACTCGTCGGCAACGACCGC
CTCATCGTGCCTCGGAAGCTCTCTCACATGACGGACAGCGCAGCGTTCCATTCCTCGCCGCCAACAAACGGCGGT
CCCACCCGGCCGTCGCCTGTCGAGCCGGGCCATAAGCCGCCACTGCATCGGCCGGTGCCATCGTCGACGACAATC
CCCTCCCTTGTCCGTGTGGGCTCCGTCGACCAGGCGGCCGACGACGACGACGACGACGACGACGACGACGACTCT
CCCTCTCTCTGCCCGTGCCGGACGCCCGTCCGACAGCTGTCACTTGCCTCGCCGCCGGCCTCAGAGGCCCGACCC
TTCTTTTTGTCTCACGCCATTGCCGTGCAAACAACGGCAGGCCGAGACACAGCCTGCTGA
Transcript >Hirsu2|7809
ATGCCGTCCCCGCGCGTCTTCCTCGTCCGCCACGGCGAGACGGAGTGGTCCCTCAGCGGCAAGCACACTGGCCGC
ACCGACATCCCCCTCACGGCCGACGGCGAGAAGCGCGTGCGAGCCACGGGCCAGGCACTCGTCGGCAACGACCGC
CTCATCGTGCCTCGGAAGCTCTCTCACATGACGGACAGCGCAGCGTTCCATTCCTCGCCGCCAACAAACGGCGGT
CCCACCCGGCCGTCGCCTGTCGAGCCGGGCCATAAGCCGCCACTGCATCGGCCGGTGCCATCGTCGACGACAATC
CCCTCCCTTGTCCGTGTGGGCTCCGTCGACCAGGCGGCCGACGACGACGACGACGACGACGACGACGACGACTCT
CCCTCTCTCTGCCCGTGCCGGACGCCCGTCCGACAGCTGTCACTTGCCTCGCCGCCGGCCTCAGAGGCCCGACCC
TTCTTTTTGTCTCACGCCATTGCCGTGCAAACAACGGCAGGCCGAGACACAGCCTGCTGA
Gene >Hirsu2|7809
ATGCCGTCCCCGCGCGTCTTCCTCGTCCGCCACGGCGAGACGGAGTGGTCCCTCAGCGGCAAGCACACTGGCCGC
ACCGACATCCCCCTCACGGCCGACGGCGAGAAGCGCGTGCGAGCCACGGGCCAGGCACTCGTCGGCAACGACCGC
CTCATCGTGCCTCGGAAGCTCTCTCACATGTGAGTATCTCTCTGCCCTGTTCAAGTTCCTAGCTACGCTTCCCCG
CCCATGGTCTCAATGTTCTTTTCTTTCCGGTCGCCTCTCCTCACCTTCGTCTTCTTCTGCATCTTCCACACCCTC
TCTCTCGTCTCCGCTTTGGCCTGCAGAGGGCAACGGGCTGTTTCTCTCTTATGCCCGGTGCGGTTGCTTGCATGG
CCCGCAGCCGCGGTCCCCTCTGGCTTCATGTCGTCTTGATATATGTATTGTACATAATCTACCCGCTCCCGCAGC
TCTCTACCCTTCTTCCCTCTCACACCCCCCCTCTCTTTTTCCACCAGCTTGCCCTGCCGTGGCACAATACACACC
GCACGTTCCCGACGCGCGCGCACACACACACACACACACACACACACAACACACACACACACACACACACGCTCA
TACACACACTCACACACTCACTCGCTCGCTCACTCACTCACACACTCACACACTCACACACATACTCACATACAC
ACACACACACTCACACATACATACATACATACATACATACTTCCTTACTTACCTACATACACTCGCGCACGCCCG
ACGCCTGCTTTTGCACTCGCGCACGCACGCCGTTTGCCGCTGGCTATCCCATCCATACATAAACCTCTTTTTCCC
TGTCGCCTCCGCCCGCGCACGACAGTCCATCGTCAACCCCTCTGCCTCTCTCCACCCGGCGCCAGAGAGCGGGCC
AGGACGGACAGCGCAGCGTTCCATTCCTCGCCGCCAACAAACGGCGGTCCCACCCGGCCGTCGCCTGTCGAGCCG
GGCCATAAGCCGCCACTGCATCGGCCGGTGCCATCGTCGACGACAATCCCCTCCCTTGTCCGTGTGGGCTCCGTC
GACCAGGCGGCCGACGACGACGACGACGACGACGACGACGACGACTCTCCCTCTCTCTGCCCGTGCCGGACGCCC
GTCCGACAGCTGTCACTTGCCTCGCCGCCGGCCTCAGAGGCCCGACCCTTCTTTTTGTCTCACGCCATTGCCGTG
CAAACAACGGCAGGCCGAGACACAGCCTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail