Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7800
Gene name
LocationContig_475:101..10420
Strand-
Gene length (bp)10319
Transcript length (bp)9900
Coding sequence length (bp)9900
Protein length (aa) 3300

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 5.6E-75 2838 3248
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 2.3E-72 14 260
PF08659 KR KR domain 1.3E-60 1953 2126
PF00668 Condensation Condensation domain 1.2E-58 2364 2811
PF00698 Acyl_transf_1 Acyl transferase domain 2.1E-55 543 851
PF14765 PS-DH Polyketide synthase dehydratase 7.0E-55 931 1244
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 1.0E-40 269 383
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 2.4E-21 386 511
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 8.9E-17 1789 1926
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 9.2E-16 1751 1855
PF00106 adh_short short chain dehydrogenase 4.2E-08 1951 2109
PF00550 PP-binding Phosphopantetheine attachment site 1.2E-06 2243 2303

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 9 1114 0.0E+00
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 11 1184 0.0E+00
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 1240 0.0E+00
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 11 1184 0.0E+00
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 10 1229 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 9 1114 0.0E+00
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 11 1184 0.0E+00
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 1240 0.0E+00
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 11 1184 0.0E+00
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 10 1229 0.0E+00
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 9 1184 3.0E-154
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 9 1184 3.0E-151
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 2 1158 5.0E-148
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 11 1243 3.0E-145
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 11 1243 3.0E-145
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 11 1243 9.0E-145
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 15 920 3.0E-139
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 4 1165 8.0E-138
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 12 1163 6.0E-136
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1924 3297 3.0E-135
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 11 915 8.0E-135
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 11 938 3.0E-134
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 10 830 4.0E-134
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 10 830 2.0E-133
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 9 929 3.0E-133
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 11 1275 4.0E-133
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 10 830 5.0E-133
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 11 830 4.0E-132
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 11 830 4.0E-132
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 11 830 4.0E-132
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 11 1275 1.0E-130
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 15 978 5.0E-128
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 8 1158 7.0E-128
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 8 1158 7.0E-128
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 8 1158 7.0E-128
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 8 1158 7.0E-128
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 8 1158 8.0E-128
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 9 876 2.0E-125
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 9 853 4.0E-125
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 2 915 6.0E-124
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 1 1261 8.0E-124
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 15 999 9.0E-124
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 15 999 8.0E-122
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 15 977 7.0E-121
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 1 977 2.0E-120
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 10 977 3.0E-120
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 76 1023 1.0E-118
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 67 976 2.0E-118
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 15 992 2.0E-118
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 14 1012 3.0E-118
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 1 983 5.0E-118
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 67 1021 2.0E-116
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1486 2313 3.0E-116
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 9 1152 7.0E-116
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 9 1152 7.0E-116
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 10 1156 2.0E-115
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 15 1011 8.0E-115
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 76 1012 1.0E-114
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 15 1239 2.0E-114
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 15 1003 3.0E-114
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 14 1010 6.0E-114
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 81 999 2.0E-113
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 81 999 1.0E-112
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 81 999 2.0E-112
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 14 1012 2.0E-112
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 21 977 3.0E-112
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 81 999 3.0E-112
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 76 977 5.0E-110
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 81 999 2.0E-109
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 10 977 2.0E-109
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 5 1049 2.0E-109
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 15 1003 4.0E-106
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 81 1003 8.0E-106
sp|P96284|PKS15_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks15 PE=1 SV=2 9 432 2.0E-105
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 81 1003 8.0E-105
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 10 917 2.0E-102
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 10 917 2.0E-102
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 10 917 2.0E-102
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2309 3264 4.0E-102
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 81 977 1.0E-101
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 81 1003 4.0E-101
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 4 977 6.0E-101
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2361 3263 2.0E-100
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 81 1003 3.0E-100
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 81 1003 7.0E-99
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 15 919 1.0E-98
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 81 977 1.0E-98
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 15 915 4.0E-98
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 11 977 4.0E-98
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 81 1003 7.0E-98
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2366 3264 5.0E-97
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2340 3283 9.0E-97
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 81 1003 2.0E-96
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 15 915 5.0E-95
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2366 3263 6.0E-95
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2340 3262 1.0E-94
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 3 522 5.0E-93
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 2357 3291 2.0E-92
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2367 3290 1.0E-90
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2353 3264 5.0E-90
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2358 3264 6.0E-89
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2367 3260 1.0E-88
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2361 3283 1.0E-88
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2367 3291 2.0E-88
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2353 3285 6.0E-88
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2365 3262 2.0E-87
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2341 3283 3.0E-87
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2367 3297 8.0E-87
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2367 3279 1.0E-86
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2367 3263 1.0E-84
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 11 524 2.0E-84
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 1557 2290 3.0E-83
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 1557 2290 3.0E-83
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2357 3259 3.0E-83
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2368 3260 3.0E-83
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 7 522 5.0E-82
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 15 522 1.0E-81
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2367 3276 2.0E-81
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2367 3276 3.0E-81
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2367 3291 4.0E-81
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2367 3275 4.0E-81
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 15 512 4.0E-81
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2350 3288 6.0E-81
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2356 3290 4.0E-80
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2286 3283 8.0E-79
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2346 3288 1.0E-78
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2367 3267 1.0E-78
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2357 3283 2.0E-78
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2362 3283 2.0E-78
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2367 3267 3.0E-78
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 15 524 1.0E-77
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 11 522 1.0E-77
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 5 524 1.0E-77
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 10 522 2.0E-77
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2372 3297 2.0E-77
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2361 3297 5.0E-77
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2362 3283 6.0E-77
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 2356 3277 1.0E-76
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2368 3290 7.0E-76
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2345 3275 4.0E-75
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 10 425 5.0E-75
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2369 3288 5.0E-75
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2365 3298 6.0E-75
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2359 3259 1.0E-74
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2357 3267 2.0E-74
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 1514 2289 3.0E-74
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 1514 2289 3.0E-74
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 1514 2289 3.0E-74
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 1514 2289 3.0E-74
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2336 3259 3.0E-74
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 1514 2289 4.0E-74
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2345 3260 9.0E-74
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2367 3288 2.0E-73
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2365 3259 1.0E-72
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2359 3259 2.0E-72
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 15 524 2.0E-72
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2357 3272 3.0E-72
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 2364 3274 3.0E-72
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2368 3262 3.0E-71
sp|P36189|FAS_ANSAN Fatty acid synthase (Fragment) OS=Anser anser anser GN=FASN PE=1 SV=1 14 376 5.0E-71
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 1477 2288 2.0E-70
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 10 524 2.0E-70
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2367 3298 4.0E-70
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2359 3264 4.0E-70
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2364 3292 6.0E-70
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1641 2133 8.0E-70
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2357 3259 2.0E-69
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 1513 2305 5.0E-69
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 1641 2134 9.0E-69
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2364 3264 1.0E-68
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 1641 2133 2.0E-68
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2368 3259 2.0E-68
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2353 3259 2.0E-67
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 10 522 4.0E-67
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2368 3259 5.0E-67
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2365 3290 9.0E-67
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 1680 2133 7.0E-66
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1641 2131 2.0E-65
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2394 3283 4.0E-65
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2404 3262 1.0E-64
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 1630 2157 3.0E-64
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2364 3288 6.0E-64
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1946 2719 2.0E-63
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 9 519 2.0E-63
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2363 3259 2.0E-62
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2360 3297 2.0E-62
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 1644 2282 3.0E-62
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1946 2719 6.0E-62
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2661 3263 6.0E-62
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2372 3291 7.0E-62
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 1644 2281 7.0E-62
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 1644 2278 1.0E-61
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2364 3263 3.0E-61
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 1575 2123 9.0E-61
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2408 3297 2.0E-60
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 9 442 1.0E-58
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2357 3288 7.0E-58
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2321 3296 7.0E-58
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2401 3288 2.0E-57
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1 438 1.0E-56
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2366 3290 1.0E-55
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2853 3259 1.0E-54
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 1633 2325 2.0E-53
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 6 444 2.0E-53
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2550 3259 3.0E-51
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2365 3259 7.0E-51
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 2828 3293 3.0E-50
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2401 3262 4.0E-50
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 2828 3293 4.0E-50
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 2828 3293 6.0E-50
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 2830 3283 4.0E-49
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2847 3259 8.0E-49
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 1633 2283 1.0E-48
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2363 3276 5.0E-48
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2363 3276 6.0E-48
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2736 3262 2.0E-46
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 2245 3264 6.0E-46
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 1625 2328 1.0E-45
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2392 3272 1.0E-44
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2248 3262 2.0E-43
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 2831 3272 2.0E-43
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2496 3262 2.0E-43
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 1633 2283 4.0E-43
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 1526 2285 4.0E-43
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 463 1163 5.0E-43
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 2837 3296 1.0E-42
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 1625 2324 3.0E-42
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 2831 3272 3.0E-42
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2377 3262 7.0E-42
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 1628 2300 9.0E-42
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 1483 2300 2.0E-41
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2393 3297 2.0E-41
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2732 3262 4.0E-41
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 2405 3275 6.0E-41
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 2831 3282 9.0E-41
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 1634 2283 1.0E-40
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 1628 2300 2.0E-40
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 2831 3287 3.0E-40
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 2831 3287 4.0E-40
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2741 3297 4.0E-40
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 1634 2155 5.0E-40
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 2831 3287 5.0E-40
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 2831 3282 5.0E-40
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 2831 3282 5.0E-40
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 2831 3282 5.0E-40
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 2831 3282 5.0E-40
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 2831 3282 5.0E-40
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 2831 3282 5.0E-40
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 2831 3287 5.0E-40
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 1626 2311 1.0E-39
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2731 3291 1.0E-39
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2766 3262 1.0E-39
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2731 3291 1.0E-39
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 2800 3275 1.0E-39
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 2800 3275 1.0E-39
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2766 3262 2.0E-39
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 2828 3298 2.0E-39
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 2831 3287 2.0E-39
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 2831 3287 2.0E-39
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 2831 3287 2.0E-39
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 1629 2286 4.0E-39
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 1546 2300 4.0E-39
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 1628 2159 5.0E-39
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 1546 2300 8.0E-39
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 2831 3287 1.0E-38
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 1612 2306 2.0E-38
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2741 3259 2.0E-38
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 2831 3287 2.0E-38
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 2828 3298 3.0E-38
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 1629 2303 4.0E-38
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2496 3264 4.0E-38
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2780 3259 8.0E-38
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1576 2300 1.0E-37
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2591 3264 1.0E-37
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 1628 2300 3.0E-37
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 1483 2300 3.0E-37
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 1633 2283 3.0E-37
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 1628 2303 5.0E-37
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 1627 2331 7.0E-37
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2760 3262 7.0E-37
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 2736 3288 7.0E-37
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 1623 2329 4.0E-36
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 1632 2315 5.0E-36
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 1627 2299 6.0E-36
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 1628 2300 6.0E-36
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 1628 2283 7.0E-36
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 2831 3262 9.0E-36
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2747 3262 9.0E-36
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 1632 2318 1.0E-35
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 1628 2300 8.0E-35
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 1628 2327 1.0E-34
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 1623 2329 3.0E-34
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1968 2310 4.0E-34
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2401 3265 4.0E-34
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 1628 2300 6.0E-34
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2743 3290 6.0E-34
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2479 3262 7.0E-34
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2365 3267 7.0E-34
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2777 3276 1.0E-33
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 2830 3275 1.0E-33
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2839 3266 4.0E-33
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 2833 3272 7.0E-33
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 2831 3272 9.0E-33
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 2833 3272 1.0E-32
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 2833 3272 1.0E-32
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 2833 3272 1.0E-32
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 2833 3272 1.0E-32
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 2833 3272 1.0E-32
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 2833 3272 1.0E-32
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 2833 3272 1.0E-32
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 2829 3276 1.0E-32
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 2830 3283 2.0E-32
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 2829 3276 2.0E-32
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 2829 3276 2.0E-32
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 2833 3272 3.0E-32
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 2833 3272 3.0E-32
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 2833 3272 3.0E-32
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 2833 3272 3.0E-32
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 2833 3272 3.0E-32
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 2833 3272 3.0E-32
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 2830 3283 6.0E-32
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 1629 2318 9.0E-32
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 2830 3283 1.0E-31
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 2833 3272 1.0E-31
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 2830 3290 1.0E-31
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2835 3297 1.0E-31
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 2831 3272 1.0E-31
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 2830 3283 2.0E-31
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 2829 3274 3.0E-31
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 2830 3283 4.0E-31
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 2617 3262 4.0E-31
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2833 3259 8.0E-31
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2810 3259 1.0E-30
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 2831 3272 2.0E-30
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2853 3276 5.0E-30
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 2892 3264 9.0E-30
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 2892 3264 9.0E-30
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 2892 3264 9.0E-30
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 2892 3264 9.0E-30
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 2892 3264 9.0E-30
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 2892 3275 1.0E-29
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 2892 3275 1.0E-29
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 2892 3275 1.0E-29
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 2804 3291 4.0E-29
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2853 3262 4.0E-29
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 2614 3262 5.0E-29
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2759 3297 1.0E-28
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 2892 3264 1.0E-28
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 2892 3264 1.0E-28
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 2857 3260 1.0E-28
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2895 3259 2.0E-28
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2833 3262 2.0E-28
sp|Q83E37|FABF_COXBU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fabF PE=1 SV=1 14 432 2.0E-28
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2823 3260 2.0E-28
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 2829 3260 7.0E-28
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 2892 3260 9.0E-28
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 2892 3260 9.0E-28
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 2892 3260 1.0E-27
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 2892 3260 1.0E-27
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 2892 3260 1.0E-27
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 2892 3260 1.0E-27
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 2892 3260 1.0E-27
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 2892 3260 1.0E-27
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 2892 3260 1.0E-27
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 2892 3260 1.0E-27
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2756 3264 1.0E-27
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2756 3264 2.0E-27
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 2892 3260 3.0E-27
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2826 3298 4.0E-27
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2823 3260 6.0E-27
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2823 3260 6.0E-27
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 2829 3295 1.0E-26
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 2976 3275 1.0E-26
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 2829 3295 2.0E-26
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2766 3270 3.0E-26
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 2831 3262 4.0E-26
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2497 3264 7.0E-26
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 1620 1841 7.0E-26
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 2826 3262 1.0E-25
sp|P28304|QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 1620 1928 2.0E-25
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2775 3292 6.0E-25
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 2840 3259 7.0E-25
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 2595 3297 1.0E-24
sp|Q59I44|CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 1630 1929 1.0E-24
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 2582 3259 2.0E-24
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 2610 3259 2.0E-24
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2855 3258 3.0E-24
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 1631 1877 3.0E-24
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2759 3264 4.0E-24
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 1631 1877 5.0E-24
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 2817 3260 1.0E-23
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2625 3259 2.0E-23
sp|P04684|NODE_RHILT Nodulation protein E OS=Rhizobium leguminosarum bv. trifolii GN=nodE PE=3 SV=2 88 434 2.0E-23
sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 1628 1928 4.0E-23
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2890 3262 7.0E-23
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 2834 3260 1.0E-22
sp|P06231|NOE4_RHIML Nodulation protein E OS=Rhizobium meliloti GN=nodE PE=3 SV=1 88 434 1.0E-22
sp|P06230|NODE_RHIME Nodulation protein E OS=Rhizobium meliloti (strain 1021) GN=nodE PE=3 SV=1 88 434 1.0E-22
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 1967 2310 2.0E-22
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 1967 2310 2.0E-22
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 1967 2310 2.0E-22
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 499 896 2.0E-22
sp|P23902|KASC1_HORVU 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Hordeum vulgare GN=KAS12 PE=1 SV=1 46 435 2.0E-22
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 541 980 3.0E-22
sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 1603 1929 3.0E-22
sp|P72331|NODE_RHIS3 Nodulation protein E OS=Rhizobium sp. (strain N33) GN=nodE PE=3 SV=1 88 434 4.0E-22
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2774 3259 5.0E-22
sp|P52410|KASC1_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Arabidopsis thaliana GN=KAS1 PE=2 SV=2 48 435 1.0E-21
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 2831 3262 3.0E-21
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1966 2130 5.0E-21
sp|Q8NXE1|FABF_STAAW 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MW2) GN=fabF PE=1 SV=1 88 435 5.0E-21
sp|Q6GAU2|FABF_STAAS 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MSSA476) GN=fabF PE=3 SV=1 88 435 5.0E-21
sp|Q5HHA1|FABF_STAAC 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain COL) GN=fabF PE=1 SV=1 88 435 5.0E-21
sp|Q6GIA3|FABF_STAAR 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MRSA252) GN=fabF PE=3 SV=1 88 435 6.0E-21
sp|Q5TKS0|FABF_STAAU 3-oxoacyl-[acyl-carrier-protein] synthase 2 (Fragment) OS=Staphylococcus aureus GN=fabF PE=3 SV=1 88 433 1.0E-20
sp|Q7A6F8|FABF_STAAN 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain N315) GN=fabF PE=1 SV=1 88 435 1.0E-20
sp|Q99VA6|FABF_STAAM 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabF PE=3 SV=1 88 435 1.0E-20
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 1604 1843 3.0E-20
sp|O34340|FABF_BACSU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Bacillus subtilis (strain 168) GN=fabF PE=1 SV=1 91 435 8.0E-20
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 1604 1875 9.0E-20
sp|P16538|KAS1_STRGA Tetracenomycin C polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces glaucescens GN=tcmK PE=3 SV=1 9 432 9.0E-20
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2365 2804 1.0E-19
sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 1661 1927 1.0E-19
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 1661 1927 1.0E-19
sp|Q8H151|AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 2847 3264 1.0E-19
sp|Q8L3X9|KASM_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Arabidopsis thaliana GN=KAS PE=1 SV=1 147 432 1.0E-19
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 1949 2153 2.0E-19
sp|A7RK30|QORL2_NEMVE Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1 1593 1926 2.0E-19
sp|P04683|NODE_RHILV Nodulation protein E OS=Rhizobium leguminosarum bv. viciae GN=nodE PE=3 SV=2 164 434 2.0E-19
sp|P9WQD7|FAB2_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasB PE=1 SV=1 180 435 2.0E-19
sp|P9WQD6|FAB2_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasB PE=3 SV=1 180 435 2.0E-19
sp|P63457|FAB2_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasB PE=3 SV=1 180 435 2.0E-19
sp|Q8JFV8|VAT1_DANRE Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 1633 1930 2.0E-19
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 1604 1875 3.0E-19
sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 1661 1927 3.0E-19
sp|Q9D404|OXSM_MOUSE 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Mus musculus GN=Oxsm PE=1 SV=1 162 432 3.0E-19
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 1633 1931 4.0E-19
sp|P73283|FABF_SYNY3 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabF PE=1 SV=1 14 435 6.0E-19
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 1604 1843 6.0E-19
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 2829 3283 9.0E-19
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 1924 2311 1.0E-18
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 1924 2311 1.0E-18
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2857 3262 1.0E-18
sp|P19333|VAT1_TORCA Synaptic vesicle membrane protein VAT-1 OS=Torpedo californica PE=1 SV=1 1632 1841 1.0E-18
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 1924 2311 2.0E-18
sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 1604 1927 2.0E-18
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 2899 3295 2.0E-18
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1953 2143 3.0E-18
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2831 3258 3.0E-18
sp|P39525|CEM1_YEAST 3-oxoacyl-[acyl-carrier-protein] synthase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CEM1 PE=1 SV=1 14 435 6.0E-18
sp|Q9NWU1|OXSM_HUMAN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens GN=OXSM PE=1 SV=1 147 432 9.0E-18
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2828 3267 1.0E-17
sp|Q02059|KASA_STRCO Actinorhodin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5087 PE=1 SV=2 14 434 1.0E-17
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 540 842 1.0E-17
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1949 2278 2.0E-17
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1928 2158 2.0E-17
sp|O69473|FAB2_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium leprae (strain TN) GN=kasB PE=3 SV=2 180 435 2.0E-17
sp|O34877|PKSD_BACSU Polyketide biosynthesis acyltransferase homolog PksD OS=Bacillus subtilis (strain 168) GN=pksD PE=1 SV=2 541 838 3.0E-17
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2742 3259 6.0E-17
sp|O94297|OXSM_SCHPO Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.13c PE=3 SV=1 165 437 8.0E-17
sp|P43710|FABB_HAEIN 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabB PE=3 SV=1 109 435 8.0E-17
sp|P57193|FABB_BUCAI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabB PE=3 SV=1 88 435 9.0E-17
sp|O74489|QOR_SCHPO Probable quinone oxidoreductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zta1 PE=1 SV=2 1623 1887 1.0E-16
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 2857 3261 1.0E-16
sp|Q3MIE4|VAT1_RAT Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus GN=Vat1 PE=1 SV=1 1633 1931 1.0E-16
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1915 2302 3.0E-16
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 2883 3262 3.0E-16
sp|Q0VCA7|OXSM_BOVIN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Bos taurus GN=OXSM PE=2 SV=1 77 432 3.0E-16
sp|P16540|KAS1_STRVN Granaticin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces violaceoruber GN=gra-orf1 PE=3 SV=1 14 432 4.0E-16
sp|Q9KQH9|FABF_VIBCH 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabF PE=1 SV=3 77 433 4.0E-16
sp|A6QQF5|QORL2_BOVIN Quinone oxidoreductase-like protein 2 OS=Bos taurus PE=2 SV=2 1623 1841 1.0E-15
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 2830 3284 2.0E-15
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 2830 3284 2.0E-15
sp|P56902|FABF_RHIME 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Rhizobium meliloti (strain 1021) GN=fabF PE=3 SV=2 160 435 2.0E-15
sp|P42865|QOR_LEIAM Probable quinone oxidoreductase OS=Leishmania amazonensis PE=3 SV=1 1627 1856 2.0E-15
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1967 2278 3.0E-15
sp|P0AAI8|FABF_SHIFL 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Shigella flexneri GN=fabF PE=3 SV=2 160 434 3.0E-15
sp|P0AAI5|FABF_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli (strain K12) GN=fabF PE=1 SV=2 160 434 3.0E-15
sp|P0AAI6|FABF_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabF PE=3 SV=2 160 434 3.0E-15
sp|P0AAI7|FABF_ECO57 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O157:H7 GN=fabF PE=3 SV=2 160 434 3.0E-15
sp|Q9C9P4|KASC2_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic OS=Arabidopsis thaliana GN=KAS2 PE=1 SV=1 88 435 3.0E-15
sp|P41175|KAS1_STRCM Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cinnamonensis PE=3 SV=1 15 432 5.0E-15
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1967 2162 6.0E-15
sp|Q62465|VAT1_MOUSE Synaptic vesicle membrane protein VAT-1 homolog OS=Mus musculus GN=Vat1 PE=1 SV=3 1633 1931 6.0E-15
sp|Q9CBS7|FAB1_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium leprae (strain TN) GN=kasA PE=3 SV=1 180 435 7.0E-15
sp|O34825|PKSC_BACSU Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase PksC OS=Bacillus subtilis (strain 168) GN=pksC PE=1 SV=1 541 832 7.0E-15
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2843 3260 9.0E-15
sp|Q3UNZ8|QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=1 SV=1 1623 1841 1.0E-14
sp|B0BNC9|QORL2_RAT Quinone oxidoreductase-like protein 2 OS=Rattus norvegicus PE=2 SV=1 1623 1841 1.0E-14
sp|Q89AY4|FABB_BUCBP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabB PE=3 SV=1 142 435 2.0E-14
sp|A4YGN2|ACAR_METS5 Acryloyl-coenzyme A reductase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1426 PE=1 SV=1 1620 1926 2.0E-14
sp|Q975C8|ACAR_SULTO Acryloyl-coenzyme A reductase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_04800 PE=1 SV=1 1623 1928 2.0E-14
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 2832 3263 2.0E-14
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2852 3239 3.0E-14
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 2855 3272 3.0E-14
sp|Q8BGC4|ZADH2_MOUSE Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Mus musculus GN=Zadh2 PE=1 SV=1 1630 1930 4.0E-14
sp|P9WQD9|FAB1_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasA PE=1 SV=1 180 435 4.0E-14
sp|P9WQD8|FAB1_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasA PE=3 SV=1 180 435 4.0E-14
sp|H8ESN0|FAB1_MYCTE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=kasA PE=2 SV=2 180 435 4.0E-14
sp|P63455|FAB1_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasA PE=3 SV=1 180 435 4.0E-14
sp|P55338|FABF_VIBHA 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio harveyi GN=fabF PE=3 SV=2 14 437 4.0E-14
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 1949 2353 6.0E-14
sp|P40804|PKSF_BACSU Polyketide biosynthesis malonyl-ACP decarboxylase PksF OS=Bacillus subtilis (strain 168) GN=pksF PE=1 SV=3 169 433 6.0E-14
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1953 2304 1.0E-13
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2844 3255 1.0E-13
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2753 3262 1.0E-13
sp|P0A953|FABB_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli (strain K12) GN=fabB PE=1 SV=1 143 434 1.0E-13
sp|P0A954|FABB_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabB PE=3 SV=1 143 434 1.0E-13
sp|A7Z4X9|BAED_BACMF Polyketide biosynthesis acyltransferase homolog BaeD OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeD PE=1 SV=1 543 743 1.0E-13
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 2855 3259 2.0E-13
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 2833 3262 2.0E-13
sp|Q02578|KAS1_STRCN Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cyaneus GN=curA PE=3 SV=1 159 432 3.0E-13
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1947 2162 4.0E-13
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2368 2822 5.0E-13
sp|Q93QD4|FABD_STAAU Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus GN=fabD PE=3 SV=1 540 843 5.0E-13
sp|Q5HGK3|FABD_STAAC Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain COL) GN=fabD PE=3 SV=1 540 843 5.0E-13
sp|Q6GHK5|FABD_STAAR Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MRSA252) GN=fabD PE=3 SV=1 540 843 6.0E-13
sp|A7Z4Y0|BAEE_BACMF Polyketide biosynthesis protein BaeE OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeE PE=1 SV=1 541 832 7.0E-13
sp|Q7A124|FABD_STAAW Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MW2) GN=fabD PE=3 SV=1 540 843 8.0E-13
sp|Q7A5Z3|FABD_STAAN Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain N315) GN=fabD PE=1 SV=1 540 843 8.0E-13
sp|Q99UN8|FABD_STAAM Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabD PE=1 SV=1 540 843 8.0E-13
sp|P0C842|CJ052_HUMAN Putative uncharacterized protein encoded by LINC00614 OS=Homo sapiens GN=LINC00614 PE=5 SV=1 37 140 8.0E-13
sp|Q6G9Y3|FABD_STAAS Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MSSA476) GN=fabD PE=3 SV=1 540 843 9.0E-13
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 2830 3290 9.0E-13
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 2830 3290 9.0E-13
sp|Q02K94|FABB_PSEAB 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fabB PE=1 SV=1 109 435 1.0E-12
sp|Q4G176|ACSF3_HUMAN Acyl-CoA synthetase family member 3, mitochondrial OS=Homo sapiens GN=ACSF3 PE=1 SV=3 2857 3290 2.0E-12
sp|P96575|YDAB_BACSU Putative acyl--CoA ligase YdaB OS=Bacillus subtilis (strain 168) GN=ydaB PE=3 SV=2 2847 3239 2.0E-12
sp|Q59A28|QORL1_BOVIN Quinone oxidoreductase-like protein 1 OS=Bos taurus GN=CRYZL1 PE=2 SV=1 1631 1818 2.0E-12
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 2980 3261 3.0E-12
sp|O95825|QORL1_HUMAN Quinone oxidoreductase-like protein 1 OS=Homo sapiens GN=CRYZL1 PE=1 SV=2 1613 1818 3.0E-12
sp|A7Z4X8|BAEC_BACMF Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase BaeC OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeC PE=1 SV=1 541 832 4.0E-12
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1953 2333 7.0E-12
sp|O35017|YOGA_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YogA OS=Bacillus subtilis (strain 168) GN=yogA PE=3 SV=1 1608 1927 7.0E-12
sp|P43678|KAS1_STRRM Oxytetracycline polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces rimosus PE=3 SV=2 14 434 1.0E-11
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1953 2272 2.0E-11
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1953 2159 2.0E-11
sp|P38230|QOR_YEAST Probable quinone oxidoreductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZTA1 PE=1 SV=1 1629 1841 2.0E-11
sp|Q921W4|QORL1_MOUSE Quinone oxidoreductase-like protein 1 OS=Mus musculus GN=Cryzl1 PE=1 SV=1 1615 1818 2.0E-11
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 2848 3295 3.0E-11
sp|Q924D0|RT4I1_MOUSE Reticulon-4-interacting protein 1, mitochondrial OS=Mus musculus GN=Rtn4ip1 PE=1 SV=2 1579 1926 5.0E-11
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 2829 3297 5.0E-11
sp|Q8ENZ7|MENE_OCEIH 2-succinylbenzoate--CoA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menE PE=3 SV=1 2835 3296 5.0E-11
sp|Q05356|KAS1_STRHA Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces halstedii GN=sch1 PE=3 SV=1 159 432 5.0E-11
sp|Q8KA28|FABB_BUCAP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabB PE=3 SV=1 148 435 6.0E-11
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 2843 3234 7.0E-11
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 2843 3234 7.0E-11
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 2843 3234 7.0E-11
sp|Q8N4Q0|ZADH2_HUMAN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Homo sapiens GN=ZADH2 PE=1 SV=1 1630 1926 7.0E-11
sp|Q9C0Y6|YKM8_SCHPO Zinc-type alcohol dehydrogenase-like protein PB24D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.08c PE=3 SV=1 1712 1926 7.0E-11
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 2975 3285 8.0E-11
sp|Q0VC50|RT4I1_BOVIN Reticulon-4-interacting protein 1, mitochondrial OS=Bos taurus GN=RTN4IP1 PE=2 SV=1 1579 1926 1.0E-10
sp|P73242|FABD_SYNY3 Malonyl CoA-acyl carrier protein transacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabD PE=1 SV=1 540 760 1.0E-10
sp|Q58DN7|ACSF3_BOVIN Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 2857 3290 1.0E-10
sp|Q8ZKF6|ACSA_SALTY Acetyl-coenzyme A synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=acs PE=1 SV=1 2825 3262 1.0E-10
sp|O34787|PKSE_BACSU Polyketide biosynthesis protein PksE OS=Bacillus subtilis (strain 168) GN=pksE PE=1 SV=3 541 832 1.0E-10
sp|O94564|YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 1627 1926 1.0E-10
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 2822 3267 1.0E-10
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 1881 2303 2.0E-10
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 2843 3234 2.0E-10
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 2843 3234 2.0E-10
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 2843 3234 3.0E-10
sp|Q8Z1R0|ACSA_SALTI Acetyl-coenzyme A synthetase OS=Salmonella typhi GN=acs PE=3 SV=1 2825 3262 3.0E-10
sp|Q24K16|ZADH2_BOVIN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Bos taurus GN=ZADH2 PE=2 SV=1 1630 1841 5.0E-10
sp|Q8WWV3|RT4I1_HUMAN Reticulon-4-interacting protein 1, mitochondrial OS=Homo sapiens GN=RTN4IP1 PE=1 SV=2 1579 1926 7.0E-10
sp|Q9SV68|QORH_ARATH Putative quinone-oxidoreductase homolog, chloroplastic OS=Arabidopsis thaliana GN=At4g13010 PE=2 SV=1 1632 1873 7.0E-10
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 2843 3234 8.0E-10
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 1931 2123 1.0E-09
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1923 2159 1.0E-09
sp|Q838K1|MENE_ENTFA 2-succinylbenzoate--CoA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=menE PE=3 SV=1 2882 3290 1.0E-09
sp|Q7YS70|MECR_BOVIN Trans-2-enoyl-CoA reductase, mitochondrial OS=Bos taurus GN=MECR PE=1 SV=1 1629 1909 1.0E-09
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 1931 2123 2.0E-09
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 1931 2123 2.0E-09
sp|Q8FAY8|ACSA_ECOL6 Acetyl-coenzyme A synthetase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=acs PE=3 SV=1 2825 3262 2.0E-09
sp|Q9ZUC1|QORL_ARATH Quinone oxidoreductase-like protein At1g23740, chloroplastic OS=Arabidopsis thaliana GN=At1g23740 PE=2 SV=2 1621 1783 2.0E-09
sp|P49385|ADH4_KLULA Alcohol dehydrogenase 4, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH4 PE=3 SV=2 1632 1926 2.0E-09
sp|Q9R9J2|FENF_BACIU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis GN=fenF PE=1 SV=1 541 832 2.0E-09
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 2848 3263 2.0E-09
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 2848 3263 2.0E-09
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2360 2810 3.0E-09
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 2974 3265 3.0E-09
sp|P00330|ADH1_YEAST Alcohol dehydrogenase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH1 PE=1 SV=5 1632 1926 4.0E-09
sp|P00331|ADH2_YEAST Alcohol dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH2 PE=1 SV=3 1632 1926 4.0E-09
sp|O34812|YFMJ_BACSU Putative NADP-dependent oxidoreductase YfmJ OS=Bacillus subtilis (strain 168) GN=yfmJ PE=2 SV=1 1711 1926 4.0E-09
sp|Q5SKN9|LCFCS_THET8 Long-chain-fatty-acid--CoA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0604 PE=1 SV=1 2848 3240 4.0E-09
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 2843 3234 4.0E-09
sp|P59871|ACSA_MYCBO Acetyl-coenzyme A synthetase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=acsA PE=3 SV=1 2844 3298 5.0E-09
sp|P9WQD1|ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=acsA PE=1 SV=1 2844 3298 5.0E-09
sp|P9WQD0|ACSA_MYCTO Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=acsA PE=3 SV=1 2844 3298 5.0E-09
sp|Q2NXE2|ACSA_XANOM Acetyl-coenzyme A synthetase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=acsA PE=3 SV=1 2856 3267 6.0E-09
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 2843 3234 6.0E-09
sp|Q98ET8|ACSA_RHILO Acetyl-coenzyme A synthetase OS=Rhizobium loti (strain MAFF303099) GN=acsA PE=3 SV=1 2825 3267 6.0E-09
sp|P27550|ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) GN=acs PE=1 SV=2 2825 3262 7.0E-09
sp|A8AN29|ACSA_CITK8 Acetyl-coenzyme A synthetase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=acs PE=3 SV=1 2825 3262 8.0E-09
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 2843 3234 8.0E-09
sp|P49384|ADH3_KLULA Alcohol dehydrogenase 3, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH3 PE=3 SV=2 1632 1926 1.0E-08
sp|B2HIN2|FAA26_MYCMM Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD26 PE=3 SV=1 2830 3240 1.0E-08
sp|P23155|KAS1_STRCO Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5318 PE=3 SV=1 159 432 1.0E-08
sp|P97584|PTGR1_RAT Prostaglandin reductase 1 OS=Rattus norvegicus GN=Ptgr1 PE=2 SV=3 1656 1837 1.0E-08
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 2826 3264 1.0E-08
sp|Q8H0M1|QORH_SPIOL Quinone-oxidoreductase homolog, chloroplastic OS=Spinacia oleracea GN=QOR PE=1 SV=1 1632 1928 2.0E-08
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 2974 3263 2.0E-08
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 2831 3290 2.0E-08
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 2826 3264 2.0E-08
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 2843 3234 2.0E-08
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 2822 3260 2.0E-08
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 2821 3259 2.0E-08
sp|P39062|ACSA_BACSU Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 2954 3275 2.0E-08
sp|Q29073|PTGR1_PIG Prostaglandin reductase 1 OS=Sus scrofa GN=PTGR1 PE=1 SV=1 1657 1926 3.0E-08
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 2843 3234 3.0E-08
sp|Q554Z5|ACSB_DICDI Acyl-CoA synthetase short-chain family member B, mitochondrial OS=Dictyostelium discoideum GN=aslB PE=3 SV=1 2951 3282 3.0E-08
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 2857 3290 4.0E-08
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1947 2166 5.0E-08
sp|B2HIL4|FAA29_MYCMM Long-chain-fatty-acid--AMP ligase FadD29 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD29 PE=3 SV=1 2828 3240 5.0E-08
sp|P38113|ADH5_YEAST Alcohol dehydrogenase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH5 PE=1 SV=1 1620 1926 6.0E-08
sp|Q6XQ67|ADH5_SACPS Alcohol dehydrogenase 5 OS=Saccharomyces pastorianus GN=ADH5 PE=3 SV=1 1620 1926 6.0E-08
sp|Q8PF09|ACSA_XANAC Acetyl-coenzyme A synthetase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=acsA PE=3 SV=1 2856 3267 6.0E-08
sp|Q9Z311|MECR_RAT Trans-2-enoyl-CoA reductase, mitochondrial OS=Rattus norvegicus GN=Mecr PE=1 SV=1 1632 1912 6.0E-08
sp|Q02062|KASB_STRCO Actinorhodin polyketide putative beta-ketoacyl synthase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5088 PE=1 SV=1 14 380 6.0E-08
sp|Q21LV0|ACSA_SACD2 Acetyl-coenzyme A synthetase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=acsA PE=3 SV=1 2855 3262 7.0E-08
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 2839 3234 8.0E-08
sp|Q9CMW1|ACSA_PASMU Acetyl-coenzyme A synthetase OS=Pasteurella multocida (strain Pm70) GN=acsA PE=3 SV=1 2825 3291 8.0E-08
sp|O94038|ADH2_CANAL Alcohol dehydrogenase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADH2 PE=3 SV=1 1632 1926 8.0E-08
sp|Q3IZ91|CCR_RHOS4 Crotonyl-CoA reductase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ccr PE=3 SV=1 1591 1814 8.0E-08
sp|Q8X5T5|ACSA_ECO57 Acetyl-coenzyme A synthetase OS=Escherichia coli O157:H7 GN=acs PE=3 SV=1 2825 3262 8.0E-08
sp|A0R5G1|ACSA_MYCS2 Acetyl-coenzyme A synthetase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=acsA PE=3 SV=1 2852 3263 9.0E-08
sp|Q39173|P2_ARATH NADP-dependent alkenal double bond reductase P2 OS=Arabidopsis thaliana GN=P2 PE=2 SV=2 1726 1841 9.0E-08
sp|P07246|ADH3_YEAST Alcohol dehydrogenase 3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH3 PE=1 SV=2 1632 1926 9.0E-08
sp|Q9P4C2|ADH2_KLUMA Alcohol dehydrogenase 2 OS=Kluyveromyces marxianus GN=ADH2 PE=3 SV=3 1632 1926 9.0E-08
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1883 2104 1.0E-07
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 2843 3234 1.0E-07
sp|Q91YR9|PTGR1_MOUSE Prostaglandin reductase 1 OS=Mus musculus GN=Ptgr1 PE=1 SV=2 1656 1926 1.0E-07
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 2848 3234 1.0E-07
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 2967 3292 2.0E-07
sp|Q2NR28|ACSA_SODGM Acetyl-coenzyme A synthetase OS=Sodalis glossinidius (strain morsitans) GN=acs PE=3 SV=1 2825 3262 2.0E-07
sp|Q84V25|ENOXE_FRAAN 2-methylene-furan-3-one reductase OS=Fragaria ananassa GN=EO PE=1 SV=1 1621 1781 2.0E-07
sp|O07619|YHFT_BACSU Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 2975 3291 2.0E-07
sp|Q3SZJ4|PTGR1_BOVIN Prostaglandin reductase 1 OS=Bos taurus GN=PTGR1 PE=2 SV=1 1676 1926 2.0E-07
sp|C1D6V9|ACSA_LARHH Acetyl-coenzyme A synthetase OS=Laribacter hongkongensis (strain HLHK9) GN=acsA PE=3 SV=1 2825 3262 4.0E-07
sp|Q9SLN8|DBR_TOBAC 2-alkenal reductase (NADP(+)-dependent) OS=Nicotiana tabacum GN=DBR PE=1 SV=1 1678 1836 4.0E-07
sp|P20369|ADH1_KLULA Alcohol dehydrogenase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH1 PE=3 SV=1 1632 1926 5.0E-07
sp|Q9DCS3|MECR_MOUSE Trans-2-enoyl-CoA reductase, mitochondrial OS=Mus musculus GN=Mecr PE=1 SV=2 1632 1913 6.0E-07
sp|O13440|ACSA_COPCI Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea GN=ACS-1 PE=2 SV=1 2827 3266 6.0E-07
sp|Q7NSY7|ACSA_CHRVO Acetyl-coenzyme A synthetase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=acsA PE=3 SV=1 2825 3262 7.0E-07
sp|Q8P3L1|ACSA_XANCP Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=acsA PE=3 SV=1 2856 3267 7.0E-07
sp|Q4UP35|ACSA_XANC8 Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=acsA PE=3 SV=1 2856 3267 7.0E-07
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 2941 3281 8.0E-07
sp|Q89WV5|ACSA_BRADU Acetyl-coenzyme A synthetase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=acsA PE=1 SV=2 2825 3262 8.0E-07
sp|B8FIN2|ACSA_DESAA Acetyl-coenzyme A synthetase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=acsA PE=3 SV=1 2856 3259 1.0E-06
sp|Q6GQN8|MECR_DANRE Trans-2-enoyl-CoA reductase, mitochondrial OS=Danio rerio GN=mecr PE=2 SV=2 1628 1779 1.0E-06
sp|Q6WAU0|PULR_MENPI (+)-pulegone reductase OS=Mentha piperita PE=1 SV=1 1726 1836 2.0E-06
sp|O85140|FABD_SALTY Malonyl CoA-acyl carrier protein transacylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabD PE=1 SV=3 540 718 2.0E-06
sp|Q941I0|ENOXC_FRAAN 2-methylene-furan-3-one reductase OS=Fragaria ananassa GN=EO PE=1 SV=2 1621 1781 2.0E-06
sp|A8PDE3|ACSA_COPC7 Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ACS-1 PE=3 SV=1 2827 3266 2.0E-06
sp|A0KNI2|ACSA_AERHH Acetyl-coenzyme A synthetase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=acsA PE=3 SV=1 2825 3267 3.0E-06
sp|K4BW79|ENOX_SOLLC 2-methylene-furan-3-one reductase OS=Solanum lycopersicum GN=EO PE=1 SV=1 1628 1783 3.0E-06
sp|Q8IVS2|FABD_HUMAN Malonyl-CoA-acyl carrier protein transacylase, mitochondrial OS=Homo sapiens GN=MCAT PE=1 SV=2 529 826 3.0E-06
sp|A1U2S9|ACSA_MARHV Acetyl-coenzyme A synthetase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=acsA PE=3 SV=1 2825 3262 3.0E-06
sp|Q9EQZ5|PTGR1_CAVPO Prostaglandin reductase 1 OS=Cavia porcellus GN=Ptgr1 PE=1 SV=1 1671 1895 3.0E-06
sp|P43712|FABD_HAEIN Malonyl CoA-acyl carrier protein transacylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabD PE=3 SV=1 540 842 3.0E-06
sp|Q2LW77|ACSA_SYNAS Acetyl-coenzyme A synthetase OS=Syntrophus aciditrophicus (strain SB) GN=acsA PE=3 SV=1 2855 3262 4.0E-06
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 2856 3234 4.0E-06
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 904 1153 5.0E-06
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 904 1156 5.0E-06
sp|O23939|ENOX_FRAVE 2-methylene-furan-3-one reductase OS=Fragaria vesca GN=EO PE=2 SV=2 1621 1781 5.0E-06
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 2976 3283 5.0E-06
sp|Q87C00|ACSA_XYLFT Acetyl-coenzyme A synthetase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=acsA PE=3 SV=1 2856 3262 6.0E-06
sp|B2JD61|ACSA_BURP8 Acetyl-coenzyme A synthetase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=acsA PE=3 SV=1 2845 3298 8.0E-06
sp|P49383|ADH2_KLULA Alcohol dehydrogenase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH2 PE=3 SV=2 1632 1926 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7800
MAPRVNGPAEDPSVIVGLACRVPGASTPSKLWESIAEQRDVQRPMPKDRFNVDAFFHPEPTHKATTNARFGYFLD
QDIGNFDAGFFGISGKEAEAMDPQQRMLLEVVYEALENAGITLQEIRGSSTSVFCGCFTNDYNAMLTKDLEYYPK
YTVTGTGDAILSNRISYFYDLHGTSVTVDTACSSSLVCFHLGNQTLQNGESDISIIVGSSLHFDTNIFVTMTDLG
MLSTSGRCAAFDSSGSGYVRGEGIACAILKRKSDAVSHGDNIRAVIRATGTNHDGKKNGITLPNSVAQEQLIRST
YEKAGLNPNDTQYFEAHGTGTAAGDPLETRAIGAVFAAGREQPLYVGSVKTNIGHLEGASGLAGVIKTAMALERG
LIPPNMHFKNPNPKIDFENWKIAVPTQVTEWKVPEGVARRASINSFGYGGTNAHVVLEEYCKEPETPAPAVSGPI
ANGVHSRPYLVPLTSHSAKAGELSEETLSSYLKGSEDVAITDLAYSLATRRTLHSQRSFVVAGDSAGLVEQLCAP
RPAAPWTASMNTAPRLGFIFTGQGAQWHAMGRQLIEESPHFRQSLQRCDAILQELPDGPEWSVVAELGKTKETSL
LGETLYSQTICTALQLALVDLMECWGIKPSAVVGHSSGEMGAAYAAGILSFESALIAAYYRGRYMSASRKDGVRG
GMMAVGLPESKCLEELKPYAGRLTIAAVNSPSTMTVSGDEDAILELKEKLTERKVFVRQLIVKQAFHSHHMFPLA
PAYEGALKNCDSFKTQPAKCRMFSSVTSRLADHEKMGASYWAANMVQAVRFSDALTGILLDEQDDKNVDVLVEIG
PHPALKGPARQTVQALKLDLPYVASLTRGVPDFQGLLNMAGTLFSLGYPVDLVAANENLSRGPDGALVRTSTGSM
LGDLPTYTWDHRRYWSETRPIREHRQREFRHSTLGHRVAGSVAKHPLFRNYLRMSELPWLNEHVVENKIVFPGAG
YISMAIEAAIRTDEAESVKMIHFKDIVVKNALLMPTTDEGVEVLLELKPVTLSAKSHSDNWYEFNVFSYDDNSNC
TSHCHGLISIEKGEAAPLAYTASYPEGTAFAELRKKTYRSMPVGNFYKNMADLGLAYGEKFRLLKGNVESGAGFS
VCDLVFDPSVLPNDPGDETVLHPTLLDSFFHVIYHAIEDRLGRPIDEPYVPSFFRSLTISGNFFDWKSNTDARHF
QVGSFTELPSPRVAINNMMMQNDDGELMMEIAGLEVTSLGREAPEGQGPRVLFYRQRWQPFFDMMTNVKGKPVSE
IVDIFAHQFPNTSILHVTSDLGRTDEVIRSLGAGKGERRRFKKLDVCSLKGKDFGAEAEELSRSCRGLVNVTAEP
QADSYDLVVVSESGVDAASFIKEDGCIVLEGEGQAPPAAGFCQVFSSPACTALRKVSEPFEPPSALSVVVPDSKM
SARTSVILSELQSAYGGRLTQTTFSEMASSTAALADDVIVLACLDDSASDAAVFKGAQALLVSLQKNTVWLTESA
TLEAARPDCAMYLGLVRTARSENDTVRAIAFDCGLDSSAQSVAANLLRLLDGRITEDEITERAGVFYIPRVEADD
DRNCKLRNGPNQEPRLEPLGTPKTRAPLALRIGKVGLLETLYFGEDTEITDREIGENEVEIETKASAINFRDIAA
SMGIIEDFKLGDECAGICTKVGAKVKDFKAGDRVVALRPGQGAHRSVVRNPASWCAKVPDDMSFADAAAMPLILS
TAWFALDHTARLRKGETVLIHAAAGGVGQMAVQIAQRAGARILATVGSPAKRQLLRDVYGLAEDQMFSSRDASFA
KGVMDATDGKGVDVVLNSLAGPLLHASWACLAPFGRFLEIGKRDIHENSKIAMDPFRRNVLFASIDLVTMFERNE
ALGERLFKECCELIANGEIRAPATIKEVPYADVIQGFRLLQKGKHTGKIVLIPQPEDMVPVMHSGYRHVKLFSPS
KHYLLVGGLGGLGRTLSQWMVRKGAMKLAFLSRSGADKAEAKATVDWLTDRGVEVNVYRGDVSRRADVQRCVDAI
GPELGGVFQAAMVLQDKPLETMTYEQWQRCCQPKVEGTRNLHEATLGIDLDFFICFSSLAAIAGSKGQANYSAAN
TYIDALMRHRRGLGLRGTTMNVGAVTGVGVVAENEELQKIMLRMGMDTINEDELLFQLEEAVMAERCSPALTARG
CTGHQIISGVGLISPEVYWAGKPLMKNLYSNHDFGSEGAGQASKNLLALLREEPDVEKRTEILLDGFLEKIASVL
ATPRESILPGNPLSAYGLDSIVAVEFRKWFRKEAQVDIALFDILGAASINALVSKTARMVATRAAVKEGAGADKT
DKKAAAEAGSGGAGAGAGEQEGAVSAMASGQLTKSQPTGIVPLSTFQSRLWFVHSFLEDKAFLNLPVVLRMKGKP
DYAVLQRAIHEMAVRNPALRTAFFEGDDFAVQEPIEDFDLGIDYADLTGEPDREKALQELVRHNRGLEMNVEGGE
VATYCLAKLGEEDWAIVGMNHHISIDRASLFPMMSQFVAVYDAIRTGQDLATVSAPEFSYVDFTLWHNARLASDL
MKPDLAWWRSTLQGLPQSSKVLPFAKGERPVRSDPRRRKVKTNLDAKLFSRMKRIAAQSNGTPFHFVLAAFRAFI
YRHTEEKDLVLLVVDGSRPHPDTDPLMGFFVNLAPVRCNDDCDVSFDQLFQITKARALDAMAHSGVPFDTIVDMM
NVKKTSSHMPVGQIAVNYQIHGPVPTYQTVDFVVEDIESDDIPTAADIQLEAIETSEHSLDFKVEYSTALYHDAD
MERFLDNFNTFLASCIQDHRQPVDEINMCGALETDLLRRQYWNTETRENQWGEDSVLDVISKMARQHPHATAIKT
SDGCSVSYRRLVERAEGVASELLDAGAAPGGRIGLVALPGAEAVAGMLGALMTGSGYVALDPDFAHDRLSFMLAD
SGAGLLLVGPGQEALAAELVSKTANPPKVIGIEDAAATGRTVARPRARHPDDPFYMIYTSGSTGTPKGVVLKESN
TQAMLSTLNKDYGFSASDKFLAHTTMSFDLSIVQIFSGLTAGATVSVASWETRKDPAALADFMMAEGVSVTYFTP
TQFSLLMEVNAEALRKCSDYRVAYFAGERLPVRVARAFYDLGTPATLYNTWSPSELVVQTSIAKIGYPEEGVVSL
PIGYPMDNCRHYLLDGRGRPVPRGQIGELAVGGAQVGAGYLNRPEANARSFVEDPFASDEDRARGWGTMFKTGDR
GRFRPDGQLEFHGRIAGDKQIKLRGFRIDLGEVEQVIFKESQGLRRAGALVDVAVVARAVAGGPDEEQQLVACP*
Coding >Hirsu2|7800
ATGGCCCCTCGTGTCAACGGACCCGCCGAGGACCCCAGCGTCATCGTCGGCCTGGCTTGTCGAGTTCCGGGAGCC
AGCACCCCGAGTAAGCTCTGGGAGAGCATCGCAGAACAGCGCGATGTTCAGCGGCCCATGCCCAAGGATAGGTTC
AACGTGGATGCCTTTTTCCACCCTGAGCCAACCCACAAGGCTACTACCAATGCACGCTTCGGTTACTTCCTCGAC
CAGGATATTGGCAATTTCGATGCCGGCTTCTTCGGCATCTCGGGCAAAGAGGCCGAAGCCATGGACCCCCAGCAG
CGTATGCTGCTGGAAGTCGTCTATGAAGCCCTGGAGAATGCTGGCATCACTCTTCAGGAGATCCGGGGATCTTCC
ACCTCGGTATTCTGCGGCTGCTTCACGAATGACTACAATGCGATGCTCACCAAGGACTTGGAATACTATCCCAAG
TACACCGTTACCGGCACCGGTGATGCCATCCTCTCGAACCGGATCTCGTACTTCTATGATCTACATGGTACCAGC
GTGACTGTTGATACCGCCTGCTCTTCTTCTCTGGTTTGCTTCCACCTTGGCAACCAGACGCTGCAGAACGGCGAG
TCCGACATCTCCATCATCGTCGGCTCATCCCTGCATTTTGACACCAACATCTTTGTGACCATGACCGATCTCGGC
ATGCTGTCCACCAGCGGCCGCTGCGCGGCCTTCGATTCTTCCGGCAGCGGCTACGTCCGAGGCGAGGGCATCGCC
TGCGCCATCCTCAAGCGCAAGTCCGACGCCGTGTCCCACGGAGACAACATCCGCGCCGTCATCCGCGCGACGGGC
ACGAACCACGACGGCAAGAAGAATGGCATCACTCTGCCCAACTCGGTCGCCCAGGAGCAGCTCATCCGGTCCACC
TACGAAAAGGCCGGCCTCAACCCAAATGACACGCAGTACTTCGAGGCCCACGGGACCGGCACGGCGGCTGGCGAC
CCCCTCGAGACGCGAGCCATTGGCGCCGTCTTCGCCGCCGGCCGCGAGCAGCCGCTATACGTCGGCTCCGTCAAG
ACCAACATTGGCCATCTCGAGGGTGCCTCCGGGCTGGCTGGCGTCATCAAGACGGCCATGGCCCTCGAGCGGGGT
CTCATCCCTCCCAACATGCACTTCAAGAACCCCAACCCCAAGATCGACTTTGAGAATTGGAAGATCGCTGTGCCG
ACGCAGGTGACGGAGTGGAAGGTCCCGGAGGGCGTTGCTCGGCGTGCCAGCATCAACTCCTTCGGCTACGGGGGA
ACGAACGCCCACGTCGTCCTCGAGGAGTACTGCAAGGAGCCCGAGACGCCTGCGCCGGCTGTTTCGGGGCCCATT
GCCAACGGCGTCCACTCCCGGCCGTACCTCGTTCCCTTGACTTCCCACTCGGCCAAGGCCGGGGAGCTGTCCGAG
GAGACGCTGTCTTCGTACCTCAAGGGCTCTGAGGACGTCGCCATCACCGATCTCGCCTACAGTCTTGCTACGCGC
CGCACCCTGCACAGCCAGCGGTCCTTCGTCGTCGCGGGCGACTCCGCCGGCCTGGTCGAGCAGCTTTGCGCGCCA
CGGCCCGCTGCTCCCTGGACGGCGTCCATGAACACCGCTCCCCGGCTCGGCTTCATCTTCACGGGCCAGGGCGCG
CAGTGGCACGCCATGGGCCGCCAGCTCATCGAGGAGAGCCCGCACTTCCGCCAGAGCCTGCAGCGCTGCGATGCC
ATCCTGCAGGAGCTGCCGGACGGCCCGGAGTGGTCCGTCGTGGCCGAGCTGGGCAAGACCAAGGAGACTTCCCTG
CTGGGCGAGACGCTTTACTCCCAGACCATCTGCACTGCCCTGCAGCTGGCGCTGGTGGATCTCATGGAGTGCTGG
GGCATCAAGCCCTCGGCCGTTGTCGGCCACTCCTCCGGTGAGATGGGCGCCGCATACGCCGCCGGCATTCTCTCC
TTCGAGAGCGCCCTCATCGCCGCCTATTACCGCGGCCGCTACATGTCGGCCAGCCGGAAGGACGGTGTCCGCGGC
GGCATGATGGCCGTCGGCCTGCCGGAGAGCAAGTGCCTGGAGGAGCTCAAGCCCTACGCCGGCCGCCTGACCATC
GCTGCCGTCAACAGCCCCTCGACCATGACGGTTTCCGGCGACGAGGACGCCATCCTCGAGCTGAAGGAGAAGCTG
ACGGAGAGGAAGGTCTTTGTCCGCCAGCTCATCGTCAAGCAGGCGTTCCACTCCCACCACATGTTCCCTCTCGCG
CCCGCGTACGAGGGGGCCCTGAAGAACTGCGACAGCTTCAAGACGCAGCCGGCCAAGTGCCGCATGTTCTCGAGT
GTCACTTCGCGTCTGGCCGACCACGAGAAGATGGGCGCCTCGTACTGGGCGGCCAACATGGTGCAGGCTGTGCGC
TTCTCCGATGCCCTCACCGGCATTCTCCTCGACGAGCAGGATGACAAGAACGTCGATGTGCTGGTGGAAATCGGC
CCTCATCCGGCCTTGAAGGGCCCCGCTCGCCAGACCGTCCAGGCTCTCAAGCTGGACCTGCCCTACGTCGCCTCC
CTCACCCGCGGCGTGCCCGACTTCCAGGGCCTCCTCAACATGGCCGGCACTCTCTTCTCCCTGGGCTACCCCGTC
GACCTGGTCGCCGCCAACGAGAACCTCAGCCGCGGGCCGGACGGCGCTCTAGTGAGGACATCGACCGGCTCCATG
CTGGGGGACCTTCCCACCTACACTTGGGACCACCGCCGCTACTGGTCCGAGACGCGCCCCATCAGGGAGCACCGC
CAGAGGGAGTTCCGTCACTCGACCCTGGGCCACCGCGTCGCCGGCTCCGTCGCCAAGCATCCTCTGTTCCGTAAC
TACCTGCGCATGAGCGAGCTGCCGTGGCTGAACGAGCACGTGGTCGAGAACAAGATCGTGTTCCCCGGCGCCGGC
TACATCAGCATGGCCATTGAGGCCGCGATTCGCACCGACGAGGCCGAGAGCGTCAAGATGATCCACTTCAAGGAC
ATCGTCGTCAAGAATGCGCTGCTGATGCCCACCACGGACGAGGGGGTCGAGGTTCTCCTGGAGCTGAAGCCCGTG
ACCCTGTCGGCCAAGAGCCACTCCGACAACTGGTACGAGTTCAACGTCTTCTCGTACGACGACAACTCGAACTGC
ACCAGCCACTGCCACGGCCTCATCAGCATCGAGAAGGGCGAGGCCGCCCCTCTCGCCTACACGGCCTCGTATCCC
GAGGGCACCGCCTTCGCCGAGCTGCGCAAGAAGACGTACCGCTCGATGCCCGTCGGGAACTTCTACAAGAACATG
GCGGACCTCGGCCTTGCCTACGGCGAGAAGTTCCGCCTCTTGAAGGGCAACGTCGAGAGCGGCGCCGGCTTCTCC
GTCTGCGACCTCGTCTTCGACCCGTCCGTCCTGCCCAACGACCCCGGCGACGAGACTGTCCTGCACCCGACCCTG
CTCGACTCATTCTTCCACGTCATCTACCACGCCATCGAGGATCGCCTCGGCCGCCCCATTGACGAGCCCTACGTC
CCGTCCTTCTTCCGCTCCCTGACCATCTCGGGCAACTTCTTCGACTGGAAGAGCAACACGGACGCCAGGCACTTC
CAGGTCGGCTCCTTCACCGAGCTCCCCTCGCCGCGCGTCGCCATCAACAACATGATGATGCAGAACGACGACGGC
GAGCTCATGATGGAGATTGCCGGCCTCGAGGTCACGTCGCTCGGGCGCGAGGCTCCCGAGGGCCAGGGCCCCCGC
GTGCTGTTTTACCGCCAGCGCTGGCAGCCCTTCTTCGACATGATGACCAACGTCAAGGGCAAGCCCGTGTCGGAG
ATTGTCGACATCTTCGCCCACCAGTTCCCCAACACCAGCATCCTGCACGTCACGTCGGATCTGGGGCGCACGGAC
GAGGTCATCCGCTCGCTGGGCGCCGGCAAGGGCGAGCGTCGGCGCTTCAAGAAGCTCGACGTCTGCTCGCTCAAG
GGTAAGGACTTCGGCGCGGAGGCCGAGGAGCTGTCCAGATCCTGCAGGGGTCTCGTCAACGTCACCGCCGAGCCC
CAGGCCGACTCGTACGACCTCGTCGTGGTCAGCGAGTCCGGGGTCGACGCCGCCTCGTTCATCAAGGAGGACGGC
TGCATCGTCCTCGAGGGCGAGGGCCAGGCTCCTCCTGCTGCCGGATTTTGCCAGGTCTTTTCCAGTCCAGCCTGC
ACGGCACTCCGCAAGGTTTCCGAGCCTTTCGAGCCGCCGTCGGCGCTGTCCGTCGTCGTCCCGGATAGCAAGATG
TCGGCTCGCACCTCCGTCATCCTCAGTGAGCTGCAGTCCGCCTACGGCGGCAGGCTCACCCAGACCACCTTTTCC
GAGATGGCCTCCAGCACGGCGGCTCTGGCGGACGACGTGATTGTGCTGGCCTGCCTGGACGACTCGGCCTCCGAC
GCGGCCGTCTTCAAGGGCGCCCAGGCCCTGCTCGTCTCCCTCCAGAAGAACACCGTCTGGCTCACGGAGAGCGCG
ACGCTCGAGGCCGCCCGTCCGGACTGTGCCATGTACCTGGGTCTTGTCCGCACGGCCAGGTCGGAGAACGACACG
GTCCGCGCGATCGCTTTCGACTGCGGCCTCGACTCGTCCGCCCAGTCCGTGGCCGCCAATCTGCTCCGTCTCCTC
GACGGCAGAATCACCGAGGACGAGATCACGGAGCGCGCCGGCGTCTTCTACATTCCCCGGGTCGAGGCCGACGAC
GATCGCAACTGCAAGCTCCGGAACGGCCCCAACCAAGAGCCCCGCCTGGAGCCGCTGGGCACGCCCAAGACTCGG
GCGCCCCTGGCCCTCCGCATCGGCAAGGTCGGTCTGCTGGAGACGCTGTACTTTGGCGAGGACACCGAGATCACG
GACCGCGAGATCGGGGAGAACGAGGTCGAGATCGAGACCAAGGCCTCGGCCATCAACTTCCGCGACATCGCCGCC
AGCATGGGCATCATCGAGGACTTCAAGCTCGGCGACGAGTGCGCCGGCATCTGCACCAAGGTCGGCGCCAAGGTC
AAGGACTTCAAGGCCGGCGACCGCGTCGTCGCCCTCCGCCCGGGCCAGGGCGCGCACAGGAGCGTCGTCCGCAAC
CCGGCCTCGTGGTGCGCCAAGGTGCCGGACGACATGTCCTTTGCCGACGCCGCGGCCATGCCCCTCATCCTGAGC
ACGGCCTGGTTCGCGCTGGACCACACGGCACGGCTGCGCAAGGGCGAGACGGTCCTCATCCACGCCGCCGCCGGT
GGCGTCGGGCAGATGGCCGTCCAGATCGCCCAGCGCGCGGGCGCCCGCATCCTCGCCACCGTCGGCTCCCCCGCC
AAGCGGCAGCTCCTCCGGGACGTCTACGGCCTCGCCGAGGACCAGATGTTCTCGTCGCGAGACGCCTCCTTCGCC
AAGGGCGTCATGGACGCCACCGACGGCAAGGGCGTCGACGTCGTGCTCAACAGTCTGGCGGGCCCCCTCCTCCAC
GCCTCTTGGGCGTGCCTCGCCCCCTTCGGCCGCTTCCTGGAGATTGGAAAGCGTGACATCCACGAGAACAGCAAG
ATCGCCATGGACCCCTTCCGGCGCAACGTCCTCTTCGCCTCCATCGACCTCGTCACCATGTTCGAGAGGAACGAG
GCCCTCGGCGAGAGGCTGTTCAAGGAATGCTGCGAGCTGATCGCCAACGGCGAGATCAGGGCGCCGGCCACCATC
AAGGAAGTTCCCTACGCCGACGTCATCCAGGGCTTCCGTCTGCTGCAGAAGGGCAAGCACACCGGCAAGATCGTC
CTCATCCCCCAGCCCGAGGACATGGTCCCCGTCATGCACAGCGGCTACCGCCACGTCAAGCTCTTCAGCCCCTCC
AAGCACTACCTCCTGGTCGGCGGCCTCGGCGGCCTGGGCCGGACCCTGTCCCAGTGGATGGTGCGCAAGGGCGCC
ATGAAGCTGGCCTTCCTCTCCCGGTCCGGCGCCGACAAGGCCGAGGCCAAGGCCACGGTGGACTGGCTCACGGAC
CGCGGCGTTGAGGTCAACGTGTACCGGGGCGACGTCTCCCGGCGCGCCGACGTCCAGCGCTGCGTCGACGCCATC
GGCCCGGAGCTCGGCGGCGTCTTCCAGGCGGCCATGGTCCTCCAGGACAAGCCGCTCGAGACGATGACCTACGAG
CAGTGGCAGAGGTGCTGCCAGCCCAAGGTCGAGGGCACCAGGAACCTCCACGAGGCGACGCTGGGCATCGACCTG
GACTTCTTCATCTGCTTCTCCTCCCTCGCCGCCATCGCCGGCTCCAAGGGTCAGGCCAACTACTCGGCGGCGAAC
ACGTACATCGACGCCCTCATGCGCCACCGCCGCGGGCTCGGCCTCAGGGGCACGACGATGAACGTCGGCGCCGTC
ACCGGCGTCGGCGTCGTGGCCGAGAACGAGGAGCTGCAGAAGATCATGCTGAGGATGGGCATGGACACCATCAAC
GAGGACGAGCTCCTCTTCCAGCTGGAGGAGGCCGTCATGGCGGAGCGGTGCAGCCCGGCCCTGACGGCGCGCGGC
TGCACCGGCCACCAGATAATCAGCGGCGTCGGCCTGATCTCGCCCGAGGTGTACTGGGCCGGCAAGCCGCTGATG
AAGAACCTGTACTCCAACCACGACTTCGGGTCCGAGGGCGCCGGCCAGGCGTCCAAGAACCTGCTGGCGCTGCTG
AGGGAGGAGCCGGACGTGGAGAAGAGGACGGAGATCCTGCTGGACGGCTTCCTCGAGAAGATCGCCAGCGTCCTC
GCCACGCCCAGGGAGTCGATCCTGCCCGGCAACCCGCTGTCGGCCTACGGCCTCGACTCCATCGTCGCCGTCGAG
TTCCGGAAGTGGTTCCGCAAGGAGGCCCAGGTCGACATCGCCCTCTTCGACATCCTCGGCGCCGCGTCCATCAAC
GCGCTCGTGTCCAAGACGGCCCGCATGGTGGCCACCAGGGCCGCGGTCAAGGAGGGGGCTGGCGCCGACAAGACG
GACAAGAAGGCCGCGGCCGAGGCCGGTAGCGGCGGCGCCGGCGCCGGCGCCGGCGAGCAGGAGGGCGCCGTCTCG
GCCATGGCCAGCGGCCAGCTCACCAAGTCGCAGCCGACCGGCATCGTCCCCCTGTCCACCTTCCAGTCCCGGCTC
TGGTTCGTGCACAGCTTCCTCGAGGACAAGGCCTTCCTCAACCTGCCCGTCGTGCTCCGGATGAAGGGCAAGCCC
GACTACGCCGTCCTGCAGAGGGCCATCCACGAGATGGCGGTCCGGAACCCGGCGCTGCGGACGGCCTTCTTCGAG
GGCGACGACTTCGCCGTGCAGGAGCCGATCGAGGACTTCGACCTCGGCATCGACTACGCCGACCTGACGGGCGAG
CCGGACCGGGAGAAGGCGCTGCAGGAGCTCGTCAGGCACAACCGCGGCCTCGAGATGAACGTCGAGGGCGGCGAG
GTGGCGACCTACTGCCTGGCCAAGCTGGGCGAGGAGGACTGGGCCATCGTCGGCATGAACCACCACATCTCCATC
GACCGCGCCAGCCTGTTCCCCATGATGTCGCAGTTCGTGGCCGTCTACGACGCCATCCGCACGGGCCAGGACCTC
GCGACCGTCTCGGCGCCCGAGTTCAGCTACGTCGACTTCACGCTCTGGCACAACGCCCGCCTCGCCTCGGACCTG
ATGAAGCCCGACCTCGCGTGGTGGCGCTCGACGCTGCAGGGCCTGCCGCAGTCGAGCAAGGTGCTGCCCTTCGCC
AAGGGCGAGCGGCCCGTCCGCAGCGACCCGCGCCGGCGCAAGGTCAAGACCAACCTGGACGCGAAGCTGTTTTCG
CGCATGAAGCGCATCGCCGCCCAGTCCAACGGGACGCCCTTCCACTTCGTCCTGGCCGCCTTCAGGGCCTTCATC
TACCGCCACACCGAGGAGAAGGACCTGGTGCTGCTCGTCGTGGACGGCAGCAGGCCTCACCCGGACACGGACCCG
CTGATGGGCTTCTTCGTCAACCTGGCCCCCGTCCGCTGCAATGACGACTGCGACGTGTCCTTCGACCAGCTCTTC
CAGATCACCAAGGCGCGCGCCCTGGACGCCATGGCGCACAGCGGCGTGCCCTTCGACACCATCGTCGACATGATG
AACGTCAAGAAGACGAGCAGCCACATGCCGGTCGGGCAGATCGCCGTCAACTACCAGATCCACGGCCCCGTGCCG
ACGTACCAGACGGTCGACTTCGTGGTGGAGGACATCGAGTCCGACGACATCCCCACCGCCGCCGACATCCAGCTC
GAGGCCATCGAGACGTCGGAGCACAGCCTCGACTTCAAGGTCGAGTACTCGACGGCGCTCTACCACGACGCCGAC
ATGGAGCGCTTCCTCGACAACTTCAACACCTTCCTCGCCAGCTGCATCCAGGACCACCGCCAGCCCGTCGACGAG
ATCAACATGTGCGGCGCGCTCGAGACGGACCTGCTGAGGCGGCAGTACTGGAACACGGAGACCAGGGAGAACCAG
TGGGGCGAGGACAGCGTGCTCGACGTGATCTCCAAGATGGCAAGACAACACCCCCACGCCACGGCGATAAAAACT
TCTGACGGCTGCAGCGTATCCTACAGGCGGCTGGTAGAGCGCGCCGAGGGCGTGGCCTCTGAGCTGCTCGACGCC
GGCGCCGCGCCGGGGGGGCGGATCGGGCTCGTCGCCCTCCCCGGCGCTGAGGCCGTGGCCGGCATGCTGGGGGCG
CTGATGACGGGCTCCGGCTACGTCGCGCTCGACCCCGACTTCGCCCACGACCGCCTCTCCTTCATGCTGGCCGAC
TCCGGCGCCGGCCTCCTCCTCGTCGGGCCGGGACAGGAGGCCCTGGCCGCCGAACTCGTCTCGAAAACCGCCAAC
CCCCCAAAAGTCATCGGGATCGAGGACGCGGCCGCGACGGGCCGGACCGTGGCTCGGCCGCGCGCCCGCCATCCG
GATGACCCGTTCTACATGATTTATACGTCGGGAAGCACGGGCACGCCCAAGGGCGTGGTGCTCAAGGAGTCCAAC
ACACAAGCGATGCTGAGCACGCTCAACAAGGACTACGGCTTCTCGGCCAGCGACAAGTTCCTGGCGCACACGACC
ATGTCCTTCGACCTCTCCATCGTCCAGATCTTCTCGGGCCTGACGGCCGGCGCCACCGTCTCGGTCGCCTCGTGG
GAGACGCGCAAGGACCCGGCGGCCCTGGCCGACTTCATGATGGCCGAGGGCGTCTCCGTCACCTACTTCACCCCG
ACGCAGTTCTCGCTCCTGATGGAGGTCAACGCGGAGGCGCTCCGCAAGTGCTCCGACTACCGGGTCGCCTACTTC
GCCGGCGAGCGGCTCCCGGTGCGCGTCGCCAGGGCCTTCTACGACCTGGGCACGCCCGCGACCCTGTACAACACG
TGGTCGCCGTCGGAGCTGGTGGTGCAGACGTCCATCGCCAAGATCGGCTACCCCGAGGAGGGCGTCGTCAGCCTG
CCGATCGGGTACCCGATGGACAACTGCCGCCACTACCTGCTCGACGGCCGGGGCAGGCCGGTGCCGCGGGGCCAG
ATCGGCGAGCTGGCCGTGGGCGGCGCCCAGGTCGGGGCCGGCTACCTCAACCGGCCCGAGGCCAACGCGCGGTCC
TTCGTCGAGGACCCGTTCGCGTCGGACGAGGACCGCGCGCGCGGCTGGGGCACCATGTTCAAGACGGGCGACCGT
GGCCGGTTCCGGCCCGACGGACAACTCGAGTTCCACGGCCGCATCGCCGGCGACAAGCAGATCAAGCTGCGCGGC
TTCCGCATCGACCTCGGCGAGGTCGAGCAGGTCATCTTCAAGGAGTCGCAGGGCCTGAGGAGGGCGGGCGCGCTC
GTCGACGTGGCCGTGGTGGCGCGCGCCGTCGCCGGCGGCCCGGACGAGGAGCAGCAGCTCGTGGCCTGCCCGTGA
Transcript >Hirsu2|7800
ATGGCCCCTCGTGTCAACGGACCCGCCGAGGACCCCAGCGTCATCGTCGGCCTGGCTTGTCGAGTTCCGGGAGCC
AGCACCCCGAGTAAGCTCTGGGAGAGCATCGCAGAACAGCGCGATGTTCAGCGGCCCATGCCCAAGGATAGGTTC
AACGTGGATGCCTTTTTCCACCCTGAGCCAACCCACAAGGCTACTACCAATGCACGCTTCGGTTACTTCCTCGAC
CAGGATATTGGCAATTTCGATGCCGGCTTCTTCGGCATCTCGGGCAAAGAGGCCGAAGCCATGGACCCCCAGCAG
CGTATGCTGCTGGAAGTCGTCTATGAAGCCCTGGAGAATGCTGGCATCACTCTTCAGGAGATCCGGGGATCTTCC
ACCTCGGTATTCTGCGGCTGCTTCACGAATGACTACAATGCGATGCTCACCAAGGACTTGGAATACTATCCCAAG
TACACCGTTACCGGCACCGGTGATGCCATCCTCTCGAACCGGATCTCGTACTTCTATGATCTACATGGTACCAGC
GTGACTGTTGATACCGCCTGCTCTTCTTCTCTGGTTTGCTTCCACCTTGGCAACCAGACGCTGCAGAACGGCGAG
TCCGACATCTCCATCATCGTCGGCTCATCCCTGCATTTTGACACCAACATCTTTGTGACCATGACCGATCTCGGC
ATGCTGTCCACCAGCGGCCGCTGCGCGGCCTTCGATTCTTCCGGCAGCGGCTACGTCCGAGGCGAGGGCATCGCC
TGCGCCATCCTCAAGCGCAAGTCCGACGCCGTGTCCCACGGAGACAACATCCGCGCCGTCATCCGCGCGACGGGC
ACGAACCACGACGGCAAGAAGAATGGCATCACTCTGCCCAACTCGGTCGCCCAGGAGCAGCTCATCCGGTCCACC
TACGAAAAGGCCGGCCTCAACCCAAATGACACGCAGTACTTCGAGGCCCACGGGACCGGCACGGCGGCTGGCGAC
CCCCTCGAGACGCGAGCCATTGGCGCCGTCTTCGCCGCCGGCCGCGAGCAGCCGCTATACGTCGGCTCCGTCAAG
ACCAACATTGGCCATCTCGAGGGTGCCTCCGGGCTGGCTGGCGTCATCAAGACGGCCATGGCCCTCGAGCGGGGT
CTCATCCCTCCCAACATGCACTTCAAGAACCCCAACCCCAAGATCGACTTTGAGAATTGGAAGATCGCTGTGCCG
ACGCAGGTGACGGAGTGGAAGGTCCCGGAGGGCGTTGCTCGGCGTGCCAGCATCAACTCCTTCGGCTACGGGGGA
ACGAACGCCCACGTCGTCCTCGAGGAGTACTGCAAGGAGCCCGAGACGCCTGCGCCGGCTGTTTCGGGGCCCATT
GCCAACGGCGTCCACTCCCGGCCGTACCTCGTTCCCTTGACTTCCCACTCGGCCAAGGCCGGGGAGCTGTCCGAG
GAGACGCTGTCTTCGTACCTCAAGGGCTCTGAGGACGTCGCCATCACCGATCTCGCCTACAGTCTTGCTACGCGC
CGCACCCTGCACAGCCAGCGGTCCTTCGTCGTCGCGGGCGACTCCGCCGGCCTGGTCGAGCAGCTTTGCGCGCCA
CGGCCCGCTGCTCCCTGGACGGCGTCCATGAACACCGCTCCCCGGCTCGGCTTCATCTTCACGGGCCAGGGCGCG
CAGTGGCACGCCATGGGCCGCCAGCTCATCGAGGAGAGCCCGCACTTCCGCCAGAGCCTGCAGCGCTGCGATGCC
ATCCTGCAGGAGCTGCCGGACGGCCCGGAGTGGTCCGTCGTGGCCGAGCTGGGCAAGACCAAGGAGACTTCCCTG
CTGGGCGAGACGCTTTACTCCCAGACCATCTGCACTGCCCTGCAGCTGGCGCTGGTGGATCTCATGGAGTGCTGG
GGCATCAAGCCCTCGGCCGTTGTCGGCCACTCCTCCGGTGAGATGGGCGCCGCATACGCCGCCGGCATTCTCTCC
TTCGAGAGCGCCCTCATCGCCGCCTATTACCGCGGCCGCTACATGTCGGCCAGCCGGAAGGACGGTGTCCGCGGC
GGCATGATGGCCGTCGGCCTGCCGGAGAGCAAGTGCCTGGAGGAGCTCAAGCCCTACGCCGGCCGCCTGACCATC
GCTGCCGTCAACAGCCCCTCGACCATGACGGTTTCCGGCGACGAGGACGCCATCCTCGAGCTGAAGGAGAAGCTG
ACGGAGAGGAAGGTCTTTGTCCGCCAGCTCATCGTCAAGCAGGCGTTCCACTCCCACCACATGTTCCCTCTCGCG
CCCGCGTACGAGGGGGCCCTGAAGAACTGCGACAGCTTCAAGACGCAGCCGGCCAAGTGCCGCATGTTCTCGAGT
GTCACTTCGCGTCTGGCCGACCACGAGAAGATGGGCGCCTCGTACTGGGCGGCCAACATGGTGCAGGCTGTGCGC
TTCTCCGATGCCCTCACCGGCATTCTCCTCGACGAGCAGGATGACAAGAACGTCGATGTGCTGGTGGAAATCGGC
CCTCATCCGGCCTTGAAGGGCCCCGCTCGCCAGACCGTCCAGGCTCTCAAGCTGGACCTGCCCTACGTCGCCTCC
CTCACCCGCGGCGTGCCCGACTTCCAGGGCCTCCTCAACATGGCCGGCACTCTCTTCTCCCTGGGCTACCCCGTC
GACCTGGTCGCCGCCAACGAGAACCTCAGCCGCGGGCCGGACGGCGCTCTAGTGAGGACATCGACCGGCTCCATG
CTGGGGGACCTTCCCACCTACACTTGGGACCACCGCCGCTACTGGTCCGAGACGCGCCCCATCAGGGAGCACCGC
CAGAGGGAGTTCCGTCACTCGACCCTGGGCCACCGCGTCGCCGGCTCCGTCGCCAAGCATCCTCTGTTCCGTAAC
TACCTGCGCATGAGCGAGCTGCCGTGGCTGAACGAGCACGTGGTCGAGAACAAGATCGTGTTCCCCGGCGCCGGC
TACATCAGCATGGCCATTGAGGCCGCGATTCGCACCGACGAGGCCGAGAGCGTCAAGATGATCCACTTCAAGGAC
ATCGTCGTCAAGAATGCGCTGCTGATGCCCACCACGGACGAGGGGGTCGAGGTTCTCCTGGAGCTGAAGCCCGTG
ACCCTGTCGGCCAAGAGCCACTCCGACAACTGGTACGAGTTCAACGTCTTCTCGTACGACGACAACTCGAACTGC
ACCAGCCACTGCCACGGCCTCATCAGCATCGAGAAGGGCGAGGCCGCCCCTCTCGCCTACACGGCCTCGTATCCC
GAGGGCACCGCCTTCGCCGAGCTGCGCAAGAAGACGTACCGCTCGATGCCCGTCGGGAACTTCTACAAGAACATG
GCGGACCTCGGCCTTGCCTACGGCGAGAAGTTCCGCCTCTTGAAGGGCAACGTCGAGAGCGGCGCCGGCTTCTCC
GTCTGCGACCTCGTCTTCGACCCGTCCGTCCTGCCCAACGACCCCGGCGACGAGACTGTCCTGCACCCGACCCTG
CTCGACTCATTCTTCCACGTCATCTACCACGCCATCGAGGATCGCCTCGGCCGCCCCATTGACGAGCCCTACGTC
CCGTCCTTCTTCCGCTCCCTGACCATCTCGGGCAACTTCTTCGACTGGAAGAGCAACACGGACGCCAGGCACTTC
CAGGTCGGCTCCTTCACCGAGCTCCCCTCGCCGCGCGTCGCCATCAACAACATGATGATGCAGAACGACGACGGC
GAGCTCATGATGGAGATTGCCGGCCTCGAGGTCACGTCGCTCGGGCGCGAGGCTCCCGAGGGCCAGGGCCCCCGC
GTGCTGTTTTACCGCCAGCGCTGGCAGCCCTTCTTCGACATGATGACCAACGTCAAGGGCAAGCCCGTGTCGGAG
ATTGTCGACATCTTCGCCCACCAGTTCCCCAACACCAGCATCCTGCACGTCACGTCGGATCTGGGGCGCACGGAC
GAGGTCATCCGCTCGCTGGGCGCCGGCAAGGGCGAGCGTCGGCGCTTCAAGAAGCTCGACGTCTGCTCGCTCAAG
GGTAAGGACTTCGGCGCGGAGGCCGAGGAGCTGTCCAGATCCTGCAGGGGTCTCGTCAACGTCACCGCCGAGCCC
CAGGCCGACTCGTACGACCTCGTCGTGGTCAGCGAGTCCGGGGTCGACGCCGCCTCGTTCATCAAGGAGGACGGC
TGCATCGTCCTCGAGGGCGAGGGCCAGGCTCCTCCTGCTGCCGGATTTTGCCAGGTCTTTTCCAGTCCAGCCTGC
ACGGCACTCCGCAAGGTTTCCGAGCCTTTCGAGCCGCCGTCGGCGCTGTCCGTCGTCGTCCCGGATAGCAAGATG
TCGGCTCGCACCTCCGTCATCCTCAGTGAGCTGCAGTCCGCCTACGGCGGCAGGCTCACCCAGACCACCTTTTCC
GAGATGGCCTCCAGCACGGCGGCTCTGGCGGACGACGTGATTGTGCTGGCCTGCCTGGACGACTCGGCCTCCGAC
GCGGCCGTCTTCAAGGGCGCCCAGGCCCTGCTCGTCTCCCTCCAGAAGAACACCGTCTGGCTCACGGAGAGCGCG
ACGCTCGAGGCCGCCCGTCCGGACTGTGCCATGTACCTGGGTCTTGTCCGCACGGCCAGGTCGGAGAACGACACG
GTCCGCGCGATCGCTTTCGACTGCGGCCTCGACTCGTCCGCCCAGTCCGTGGCCGCCAATCTGCTCCGTCTCCTC
GACGGCAGAATCACCGAGGACGAGATCACGGAGCGCGCCGGCGTCTTCTACATTCCCCGGGTCGAGGCCGACGAC
GATCGCAACTGCAAGCTCCGGAACGGCCCCAACCAAGAGCCCCGCCTGGAGCCGCTGGGCACGCCCAAGACTCGG
GCGCCCCTGGCCCTCCGCATCGGCAAGGTCGGTCTGCTGGAGACGCTGTACTTTGGCGAGGACACCGAGATCACG
GACCGCGAGATCGGGGAGAACGAGGTCGAGATCGAGACCAAGGCCTCGGCCATCAACTTCCGCGACATCGCCGCC
AGCATGGGCATCATCGAGGACTTCAAGCTCGGCGACGAGTGCGCCGGCATCTGCACCAAGGTCGGCGCCAAGGTC
AAGGACTTCAAGGCCGGCGACCGCGTCGTCGCCCTCCGCCCGGGCCAGGGCGCGCACAGGAGCGTCGTCCGCAAC
CCGGCCTCGTGGTGCGCCAAGGTGCCGGACGACATGTCCTTTGCCGACGCCGCGGCCATGCCCCTCATCCTGAGC
ACGGCCTGGTTCGCGCTGGACCACACGGCACGGCTGCGCAAGGGCGAGACGGTCCTCATCCACGCCGCCGCCGGT
GGCGTCGGGCAGATGGCCGTCCAGATCGCCCAGCGCGCGGGCGCCCGCATCCTCGCCACCGTCGGCTCCCCCGCC
AAGCGGCAGCTCCTCCGGGACGTCTACGGCCTCGCCGAGGACCAGATGTTCTCGTCGCGAGACGCCTCCTTCGCC
AAGGGCGTCATGGACGCCACCGACGGCAAGGGCGTCGACGTCGTGCTCAACAGTCTGGCGGGCCCCCTCCTCCAC
GCCTCTTGGGCGTGCCTCGCCCCCTTCGGCCGCTTCCTGGAGATTGGAAAGCGTGACATCCACGAGAACAGCAAG
ATCGCCATGGACCCCTTCCGGCGCAACGTCCTCTTCGCCTCCATCGACCTCGTCACCATGTTCGAGAGGAACGAG
GCCCTCGGCGAGAGGCTGTTCAAGGAATGCTGCGAGCTGATCGCCAACGGCGAGATCAGGGCGCCGGCCACCATC
AAGGAAGTTCCCTACGCCGACGTCATCCAGGGCTTCCGTCTGCTGCAGAAGGGCAAGCACACCGGCAAGATCGTC
CTCATCCCCCAGCCCGAGGACATGGTCCCCGTCATGCACAGCGGCTACCGCCACGTCAAGCTCTTCAGCCCCTCC
AAGCACTACCTCCTGGTCGGCGGCCTCGGCGGCCTGGGCCGGACCCTGTCCCAGTGGATGGTGCGCAAGGGCGCC
ATGAAGCTGGCCTTCCTCTCCCGGTCCGGCGCCGACAAGGCCGAGGCCAAGGCCACGGTGGACTGGCTCACGGAC
CGCGGCGTTGAGGTCAACGTGTACCGGGGCGACGTCTCCCGGCGCGCCGACGTCCAGCGCTGCGTCGACGCCATC
GGCCCGGAGCTCGGCGGCGTCTTCCAGGCGGCCATGGTCCTCCAGGACAAGCCGCTCGAGACGATGACCTACGAG
CAGTGGCAGAGGTGCTGCCAGCCCAAGGTCGAGGGCACCAGGAACCTCCACGAGGCGACGCTGGGCATCGACCTG
GACTTCTTCATCTGCTTCTCCTCCCTCGCCGCCATCGCCGGCTCCAAGGGTCAGGCCAACTACTCGGCGGCGAAC
ACGTACATCGACGCCCTCATGCGCCACCGCCGCGGGCTCGGCCTCAGGGGCACGACGATGAACGTCGGCGCCGTC
ACCGGCGTCGGCGTCGTGGCCGAGAACGAGGAGCTGCAGAAGATCATGCTGAGGATGGGCATGGACACCATCAAC
GAGGACGAGCTCCTCTTCCAGCTGGAGGAGGCCGTCATGGCGGAGCGGTGCAGCCCGGCCCTGACGGCGCGCGGC
TGCACCGGCCACCAGATAATCAGCGGCGTCGGCCTGATCTCGCCCGAGGTGTACTGGGCCGGCAAGCCGCTGATG
AAGAACCTGTACTCCAACCACGACTTCGGGTCCGAGGGCGCCGGCCAGGCGTCCAAGAACCTGCTGGCGCTGCTG
AGGGAGGAGCCGGACGTGGAGAAGAGGACGGAGATCCTGCTGGACGGCTTCCTCGAGAAGATCGCCAGCGTCCTC
GCCACGCCCAGGGAGTCGATCCTGCCCGGCAACCCGCTGTCGGCCTACGGCCTCGACTCCATCGTCGCCGTCGAG
TTCCGGAAGTGGTTCCGCAAGGAGGCCCAGGTCGACATCGCCCTCTTCGACATCCTCGGCGCCGCGTCCATCAAC
GCGCTCGTGTCCAAGACGGCCCGCATGGTGGCCACCAGGGCCGCGGTCAAGGAGGGGGCTGGCGCCGACAAGACG
GACAAGAAGGCCGCGGCCGAGGCCGGTAGCGGCGGCGCCGGCGCCGGCGCCGGCGAGCAGGAGGGCGCCGTCTCG
GCCATGGCCAGCGGCCAGCTCACCAAGTCGCAGCCGACCGGCATCGTCCCCCTGTCCACCTTCCAGTCCCGGCTC
TGGTTCGTGCACAGCTTCCTCGAGGACAAGGCCTTCCTCAACCTGCCCGTCGTGCTCCGGATGAAGGGCAAGCCC
GACTACGCCGTCCTGCAGAGGGCCATCCACGAGATGGCGGTCCGGAACCCGGCGCTGCGGACGGCCTTCTTCGAG
GGCGACGACTTCGCCGTGCAGGAGCCGATCGAGGACTTCGACCTCGGCATCGACTACGCCGACCTGACGGGCGAG
CCGGACCGGGAGAAGGCGCTGCAGGAGCTCGTCAGGCACAACCGCGGCCTCGAGATGAACGTCGAGGGCGGCGAG
GTGGCGACCTACTGCCTGGCCAAGCTGGGCGAGGAGGACTGGGCCATCGTCGGCATGAACCACCACATCTCCATC
GACCGCGCCAGCCTGTTCCCCATGATGTCGCAGTTCGTGGCCGTCTACGACGCCATCCGCACGGGCCAGGACCTC
GCGACCGTCTCGGCGCCCGAGTTCAGCTACGTCGACTTCACGCTCTGGCACAACGCCCGCCTCGCCTCGGACCTG
ATGAAGCCCGACCTCGCGTGGTGGCGCTCGACGCTGCAGGGCCTGCCGCAGTCGAGCAAGGTGCTGCCCTTCGCC
AAGGGCGAGCGGCCCGTCCGCAGCGACCCGCGCCGGCGCAAGGTCAAGACCAACCTGGACGCGAAGCTGTTTTCG
CGCATGAAGCGCATCGCCGCCCAGTCCAACGGGACGCCCTTCCACTTCGTCCTGGCCGCCTTCAGGGCCTTCATC
TACCGCCACACCGAGGAGAAGGACCTGGTGCTGCTCGTCGTGGACGGCAGCAGGCCTCACCCGGACACGGACCCG
CTGATGGGCTTCTTCGTCAACCTGGCCCCCGTCCGCTGCAATGACGACTGCGACGTGTCCTTCGACCAGCTCTTC
CAGATCACCAAGGCGCGCGCCCTGGACGCCATGGCGCACAGCGGCGTGCCCTTCGACACCATCGTCGACATGATG
AACGTCAAGAAGACGAGCAGCCACATGCCGGTCGGGCAGATCGCCGTCAACTACCAGATCCACGGCCCCGTGCCG
ACGTACCAGACGGTCGACTTCGTGGTGGAGGACATCGAGTCCGACGACATCCCCACCGCCGCCGACATCCAGCTC
GAGGCCATCGAGACGTCGGAGCACAGCCTCGACTTCAAGGTCGAGTACTCGACGGCGCTCTACCACGACGCCGAC
ATGGAGCGCTTCCTCGACAACTTCAACACCTTCCTCGCCAGCTGCATCCAGGACCACCGCCAGCCCGTCGACGAG
ATCAACATGTGCGGCGCGCTCGAGACGGACCTGCTGAGGCGGCAGTACTGGAACACGGAGACCAGGGAGAACCAG
TGGGGCGAGGACAGCGTGCTCGACGTGATCTCCAAGATGGCAAGACAACACCCCCACGCCACGGCGATAAAAACT
TCTGACGGCTGCAGCGTATCCTACAGGCGGCTGGTAGAGCGCGCCGAGGGCGTGGCCTCTGAGCTGCTCGACGCC
GGCGCCGCGCCGGGGGGGCGGATCGGGCTCGTCGCCCTCCCCGGCGCTGAGGCCGTGGCCGGCATGCTGGGGGCG
CTGATGACGGGCTCCGGCTACGTCGCGCTCGACCCCGACTTCGCCCACGACCGCCTCTCCTTCATGCTGGCCGAC
TCCGGCGCCGGCCTCCTCCTCGTCGGGCCGGGACAGGAGGCCCTGGCCGCCGAACTCGTCTCGAAAACCGCCAAC
CCCCCAAAAGTCATCGGGATCGAGGACGCGGCCGCGACGGGCCGGACCGTGGCTCGGCCGCGCGCCCGCCATCCG
GATGACCCGTTCTACATGATTTATACGTCGGGAAGCACGGGCACGCCCAAGGGCGTGGTGCTCAAGGAGTCCAAC
ACACAAGCGATGCTGAGCACGCTCAACAAGGACTACGGCTTCTCGGCCAGCGACAAGTTCCTGGCGCACACGACC
ATGTCCTTCGACCTCTCCATCGTCCAGATCTTCTCGGGCCTGACGGCCGGCGCCACCGTCTCGGTCGCCTCGTGG
GAGACGCGCAAGGACCCGGCGGCCCTGGCCGACTTCATGATGGCCGAGGGCGTCTCCGTCACCTACTTCACCCCG
ACGCAGTTCTCGCTCCTGATGGAGGTCAACGCGGAGGCGCTCCGCAAGTGCTCCGACTACCGGGTCGCCTACTTC
GCCGGCGAGCGGCTCCCGGTGCGCGTCGCCAGGGCCTTCTACGACCTGGGCACGCCCGCGACCCTGTACAACACG
TGGTCGCCGTCGGAGCTGGTGGTGCAGACGTCCATCGCCAAGATCGGCTACCCCGAGGAGGGCGTCGTCAGCCTG
CCGATCGGGTACCCGATGGACAACTGCCGCCACTACCTGCTCGACGGCCGGGGCAGGCCGGTGCCGCGGGGCCAG
ATCGGCGAGCTGGCCGTGGGCGGCGCCCAGGTCGGGGCCGGCTACCTCAACCGGCCCGAGGCCAACGCGCGGTCC
TTCGTCGAGGACCCGTTCGCGTCGGACGAGGACCGCGCGCGCGGCTGGGGCACCATGTTCAAGACGGGCGACCGT
GGCCGGTTCCGGCCCGACGGACAACTCGAGTTCCACGGCCGCATCGCCGGCGACAAGCAGATCAAGCTGCGCGGC
TTCCGCATCGACCTCGGCGAGGTCGAGCAGGTCATCTTCAAGGAGTCGCAGGGCCTGAGGAGGGCGGGCGCGCTC
GTCGACGTGGCCGTGGTGGCGCGCGCCGTCGCCGGCGGCCCGGACGAGGAGCAGCAGCTCGTGGCCTGCCCGTGA
Gene >Hirsu2|7800
ATGGCCCCTCGTGTCAACGGACCCGCCGAGGACCCCAGCGTCATCGTCGGCCTGGCTTGTCGAGTTCCGGGAGCC
AGCACCCCGAGTAAGCTCTGGGAGAGCATCGCAGAACAGCGCGATGTTCAGCGGCCCATGCCCAAGGATAGGTTC
AACGTGGATGCCTTTTTCCACCCTGAGCCAACCCACAAGGCTACTGTGAGTATAAGCCTGAGCCCTAATGAACGG
GGACGGGGGCAGAAGCGACCGCAACTAACGCCCTCTTCAGACCAATGCACGCTTCGGTTACTTCCTCGACCAGGA
TATTGGCAATTTCGATGCCGGCTTCTTCGGCATCTCGGGCAAAGAGGCCGAAGCCATGGACCCCCAGCAGCGTAT
GCTGCTGGAAGTCGTCTATGAAGCCCTGGAGAATGCTGGCATCACTCTTCAGGAGATCCGGGGATCTTCCACCTC
GGTATTCTGCGGCTGCTTCACGAATGACTACAATGCGATGCTCACCAAGGACTTGGAATACTATCCCAAGTACAC
CGTGAGTGATGCCGCCTGCCAGTCTCGAGGAGAGTCAACGTGCTGACAACGATGGTCCCGCGTATAGGTTACCGG
CACCGGTGATGCCATCCTCTCGAACCGGATCTCGTACTTCTATGATCTACATGGTACCAGCGTGACTGTTGATAC
CGCCTGCTCTTCTTCTCTGGTTTGCTTCCACCTTGGCAACCAGACGCTGCAGAACGGCGAGTCCGACATCTCCAT
CATCGTCGGCTCATCCCTGCATTTTGACACCAACATCTTTGTGACCATGACCGATCTCGGCATGCTGTCCACCAG
CGGCCGCTGCGCGGCCTTCGATTCTTCCGGCAGCGGCTACGTCCGAGGCGAGGGCATCGCCTGCGCCATCCTCAA
GCGCAAGTCCGACGCCGTGTCCCACGGAGACAACATCCGCGCCGTCATCCGCGCGACGGGCACGAACCACGACGG
CAAGAAGAATGGCATCACTCTGCCCAACTCGGTCGCCCAGGAGCAGCTCATCCGGTCCACCTACGAAAAGGCCGG
CCTCAACCCAAATGACACGCAGTACTTCGAGGCCCACGGGACCGGCACGGCGGCTGGCGACCCCCTCGAGACGCG
AGCCATTGGCGCCGTCTTCGCCGCCGGCCGCGAGCAGCCGCTATACGTCGGCTCCGTCAAGACCAACATTGGCCA
TCTCGAGGGTGCCTCCGGGCTGGCTGGCGTCATCAAGACGGCCATGGCCCTCGAGCGGGGTCTCATCCCTCCCAA
CATGCACTTCAAGAACCCCAACCCCAAGATCGACTTTGAGAATTGGAAGATCGCTGTGCCGACGCAGGTGACGGA
GTGGAAGGTCCCGGAGGGCGTTGCTCGGCGTGCCAGCATCAACTCCTTCGGCTACGGGGGAACGAACGCCCACGT
CGTCCTCGAGGAGTACTGCAAGGAGCCCGAGACGCCTGCGCCGGCTGTTTCGGGGCCCATTGCCAACGGCGTCCA
CTCCCGGCCGTACCTCGTTCCCTTGACTTCCCACTCGGCCAAGGCCGGGGAGCTGTCCGAGGAGACGCTGTCTTC
GTACCTCAAGGGCTCTGAGGACGTCGCCATCACCGATCTCGCCTACAGTCTTGCTACGCGCCGCACCCTGCACAG
CCAGCGGTCCTTCGTCGTCGCGGGCGACTCCGCCGGCCTGGTCGAGCAGCTTTGCGCGCCACGGCCCGCTGCTCC
CTGGACGGCGTCCATGAACACCGCTCCCCGGCTCGGCTTCATCTTCACGGGCCAGGGCGCGCAGTGGCACGCCAT
GGGCCGCCAGCTCATCGAGGAGAGCCCGCACTTCCGCCAGAGCCTGCAGCGCTGCGATGCCATCCTGCAGGAGCT
GCCGGACGGCCCGGAGTGGTCCGTCGTGGCCGAGCTGGGCAAGACCAAGGAGACTTCCCTGCTGGGCGAGACGCT
TTACTCCCAGACCATCTGCACTGCCCTGCAGCTGGCGCTGGTGGATCTCATGGAGTGCTGGGGCATCAAGCCCTC
GGCCGTTGTCGGCCACTCCTCCGGTGAGATGGGCGCCGCATACGCCGCCGGCATTCTCTCCTTCGAGAGCGCCCT
CATCGCCGCCTATTACCGCGGCCGCTACATGTCGGCCAGCCGGAAGGACGGTGTCCGCGGCGGCATGATGGCCGT
CGGCCTGCCGGAGAGCAAGTGCCTGGAGGAGCTCAAGCCCTACGCCGGCCGCCTGACCATCGCTGCCGTCAACAG
CCCCTCGACCATGACGGTTTCCGGCGACGAGGACGCCATCCTCGAGCTGAAGGAGAAGCTGACGGAGAGGAAGGT
CTTTGTCCGCCAGCTCATCGTCAAGCAGGCGTTCCACTCCCACCACATGTTCCCTCTCGCGCCCGCGTACGAGGG
GGCCCTGAAGAACTGCGACAGCTTCAAGACGCAGCCGGCCAAGTGCCGCATGTTCTCGAGTGTCACTTCGCGTCT
GGCCGACCACGAGAAGATGGGCGCCTCGTACTGGGCGGCCAACATGGTGCAGGCTGTGCGCTTCTCCGATGCCCT
CACCGGCATTCTCCTCGACGAGCAGGATGACAAGAACGTCGATGTGCTGGTGGAAATCGGCCCTCATCCGGCCTT
GAAGGGCCCCGCTCGCCAGACCGTCCAGGCTCTCAAGCTGGACCTGCCCTACGTCGCCTCCCTCACCCGCGGCGT
GCCCGACTTCCAGGGCCTCCTCAACATGGCCGGCACTCTCTTCTCCCTGGGCTACCCCGTCGACCTGGTCGCCGC
CAACGAGAACCTCAGCCGCGGGCCGGACGGCGCTCTAGTGAGGACATCGACCGGCTCCATGCTGGGGGACCTTCC
CACCTACACTTGGGACCACCGCCGCTACTGGTCCGAGACGCGCCCCATCAGGGAGCACCGCCAGAGGGAGTTCCG
TCACTCGACCCTGGGCCACCGCGTCGCCGGCTCCGTCGCCAAGCATCCTCTGTTCCGTAACTACCTGCGCATGAG
CGAGCTGCCGTGGCTGAACGAGCACGTGGTCGAGAACAAGATCGTGTTCCCCGGCGCCGGCTACATCAGCATGGC
CATTGAGGCCGCGATTCGCACCGACGAGGCCGAGAGCGTCAAGATGATCCACTTCAAGGACATCGTCGTCAAGAA
TGCGCTGCTGATGCCCACCACGGACGAGGGGGTCGAGGTTCTCCTGGAGCTGAAGCCCGTGACCCTGTCGGCCAA
GAGCCACTCCGACAACTGGTACGAGTTCAACGTCTTCTCGTACGACGACAACTCGAACTGCACCAGCCACTGCCA
CGGCCTCATCAGCATCGAGAAGGGCGAGGCCGCCCCTCTCGCCTACACGGCCTCGTATCCCGAGGGCACCGCCTT
CGCCGAGCTGCGCAAGAAGACGTACCGCTCGATGCCCGTCGGGAACTTCTACAAGAACATGGCGGACCTCGGCCT
TGCCTACGGCGAGAAGTTCCGCCTCTTGAAGGGCAACGTCGAGAGCGGCGCCGGCTTCTCCGTCTGCGACCTCGT
CTTCGACCCGTCCGTCCTGCCCAACGACCCCGGCGACGAGACTGTCCTGCACCCGACCCTGCTCGACTCATTCTT
CCACGTCATCTACCACGCCATCGAGGATCGCCTCGGCCGCCCCATTGACGAGCCCTACGTCCCGTCCTTCTTCCG
CTCCCTGACCATCTCGGGCAACTTCTTCGACTGGAAGAGCAACACGGACGCCAGGCACTTCCAGGTCGGCTCCTT
CACCGAGCTCCCCTCGCCGCGCGTCGCCATCAACAACATGATGATGCAGAACGACGACGGCGAGCTCATGATGGA
GATTGCCGGCCTCGAGGTCACGTCGCTCGGGCGCGAGGCTCCCGAGGGCCAGGGCCCCCGCGTGCTGTTTTACCG
CCAGCGCTGGCAGCCCTTCTTCGACATGATGACCAACGTCAAGGGCAAGCCCGTGTCGGAGATTGTCGACATCTT
CGCCCACCAGTTCCCCAACACCAGCATCCTGCACGTCACGTCGGATCTGGGGCGCACGGACGAGGTCATCCGCTC
GCTGGGCGCCGGCAAGGGCGAGCGTCGGCGCTTCAAGAAGCTCGACGTCTGCTCGCTCAAGGGTAAGGACTTCGG
CGCGGAGGCCGAGGAGCTGTCCAGATCCTGCAGGGGTCTCGTCAACGTCACCGCCGAGCCCCAGGCCGACTCGTA
CGACCTCGTCGTGGTCAGCGAGTCCGGGGTCGACGCCGCCTCGTTCATCAAGGAGGACGGCTGCATCGTCCTCGA
GGGCGAGGGCCAGGCTCCTCCTGCTGCCGGATTTTGCCAGGTCTTTTCCAGTCCAGCCTGCACGGCACTCCGCAA
GGTTTCCGAGCCTTTCGAGCCGCCGTCGGCGCTGTCCGTCGTCGTCCCGGATAGCAAGATGTCGGCTCGCACCTC
CGTCATCCTCAGTGAGCTGCAGTCCGCCTACGGCGGCAGGCTCACCCAGACCACCTTTTCCGAGATGGCCTCCAG
CACGGCGGCTCTGGCGGACGACGTGATTGTGCTGGCCTGCCTGGACGACTCGGCCTCCGACGCGGCCGTCTTCAA
GGGCGCCCAGGCCCTGCTCGTCTCCCTCCAGAAGAACACCGTCTGGCTCACGGAGAGCGCGACGCTCGAGGCCGC
CCGTCCGGACTGTGCCATGTACCTGGGTCTTGTCCGCACGGCCAGGTCGGAGAACGACACGGTCCGCGCGATCGC
TTTCGACTGCGGCCTCGACTCGTCCGCCCAGTCCGTGGCCGCCAATCTGCTCCGTCTCCTCGACGGCAGAATCAC
CGAGGACGAGATCACGGAGCGCGCCGGCGTCTTCTACATTCCCCGGGTCGAGGCCGACGACGATCGCAACTGCAA
GCTCCGGAACGGCCCCAACCAAGAGCCCCGCCTGGAGCCGCTGGGCACGCCCAAGACTCGGGCGCCCCTGGCCCT
CCGCATCGGCAAGGTCGGTCTGCTGGAGACGCTGTACTTTGGCGAGGACACCGAGATCACGGACCGCGAGATCGG
GGAGAACGAGGTCGAGATCGAGACCAAGGCCTCGGCCATCAACTTCCGCGACATCGCCGCCAGCATGGGCATCAT
CGAGGACTTCAAGCTCGGCGACGAGTGCGCCGGCATCTGCACCAAGGTCGGCGCCAAGGTCAAGGACTTCAAGGC
CGGCGACCGCGTCGTCGCCCTCCGCCCGGGCCAGGGCGCGCACAGGAGCGTCGTCCGCAACCCGGCCTCGTGGTG
CGCCAAGGTGCCGGACGACATGTCCTTTGCCGACGCCGCGGCCATGCCCCTCATCCTGAGCACGGCCTGGTTCGC
GCTGGACCACACGGCACGGCTGCGCAAGGGCGAGACGGTCCTCATCCACGCCGCCGCCGGTGGCGTCGGGCAGAT
GGCCGTCCAGATCGCCCAGCGCGCGGGCGCCCGCATCCTCGCCACCGTCGGCTCCCCCGCCAAGCGGCAGCTCCT
CCGGGACGTCTACGGCCTCGCCGAGGACCAGATGTTCTCGTCGCGAGACGCCTCCTTCGCCAAGGGCGTCATGGA
CGCCACCGACGGCAAGGGCGTCGACGTCGTGCTCAACAGTCTGGCGGGCCCCCTCCTCCACGCCTCTTGGGCGTG
CCTCGCCCCCTTCGGCCGCTTCCTGGAGATTGGAAAGCGTGACATCCACGAGAACAGCAAGATCGCCATGGACCC
CTTCCGGCGCAACGTCCTCTTCGCCTCCATCGACCTCGTCACCATGTTCGAGAGGAACGAGGCCCTCGGCGAGAG
GCTGTTCAAGGAATGCTGCGAGCTGATCGCCAACGGCGAGATCAGGGCGCCGGCCACCATCAAGGAAGTTCCCTA
CGCCGACGTCATCCAGGGCTTCCGTCTGCTGCAGAAGGGCAAGCACACCGGCAAGATCGTCCTCATCCCCCAGCC
CGAGGACATGGTCCCCGTCATGCACAGCGGCTACCGCCACGTCAAGCTCTTCAGCCCCTCCAAGCACTACCTCCT
GGTCGGCGGCCTCGGCGGCCTGGGCCGGACCCTGTCCCAGTGGATGGTGCGCAAGGGCGCCATGAAGCTGGCCTT
CCTCTCCCGGTCCGGCGCCGACAAGGCCGAGGCCAAGGCCACGGTGGACTGGCTCACGGACCGCGGCGTTGAGGT
CAACGTGTACCGGGGCGACGTCTCCCGGCGCGCCGACGTCCAGCGCTGCGTCGACGCCATCGGCCCGGAGCTCGG
CGGCGTCTTCCAGGCGGCCATGGTCCTCCAGGACAAGCCGCTCGAGACGATGACCTACGAGCAGTGGCAGAGGTG
CTGCCAGCCCAAGGTCGAGGGCACCAGGAACCTCCACGAGGCGACGCTGGGCATCGACCTGGACTTCTTCATCTG
CTTCTCCTCCCTCGCCGCCATCGCCGGCTCCAAGGGTCAGGCCAACTACTCGGCGGCGAACACGTACATCGACGC
CCTCATGCGCCACCGCCGCGGGCTCGGCCTCAGGGGCACGACGATGAACGTCGGCGCCGTCACCGGCGTCGGCGT
CGTGGCCGAGAACGAGGAGCTGCAGAAGATCATGCTGAGGATGGGCATGGACACCATCAACGAGGACGAGCTCCT
CTTCCAGCTGGAGGAGGCCGTCATGGCGGAGCGGTGCAGCCCGGCCCTGACGGCGCGCGGCTGCACCGGCCACCA
GATAATCAGCGGCGTCGGCCTGATCTCGCCCGAGGTGTACTGGGCCGGCAAGCCGCTGATGAAGAACCTGTACTC
CAACCACGACTTCGGGTCCGAGGGCGCCGGCCAGGCGTCCAAGAACCTGCTGGCGCTGCTGAGGGAGGAGCCGGA
CGTGGAGAAGAGGACGGAGATCCTGCTGGACGGCTTCCTCGAGAAGATCGCCAGCGTCCTCGCCACGCCCAGGGA
GTCGATCCTGCCCGGCAACCCGCTGTCGGCCTACGGCCTCGACTCCATCGTCGCCGTCGAGTTCCGGAAGTGGTT
CCGCAAGGAGGCCCAGGTCGACATCGCCCTCTTCGACATCCTCGGCGCCGCGTCCATCAACGCGCTCGTGTCCAA
GACGGCCCGCATGGTGGCCACCAGGGCCGCGGTCAAGGAGGGGGCTGGCGCCGACAAGACGGACAAGAAGGCCGC
GGCCGAGGCCGGTAGCGGCGGCGCCGGCGCCGGCGCCGGCGAGCAGGAGGGCGCCGTCTCGGCCATGGCCAGCGG
CCAGCTCACCAAGTCGCAGCCGACCGGCATCGTCCCCCTGTCCACCTTCCAGTCCCGGCTCTGGTTCGTGCACAG
CTTCCTCGAGGACAAGGCCTTCCTCAACCTGCCCGTCGTGCTCCGGATGAAGGGCAAGCCCGACTACGCCGTCCT
GCAGAGGGCCATCCACGAGATGGCGGTCCGGAACCCGGCGCTGCGGACGGCCTTCTTCGAGGGCGACGACTTCGC
CGTGCAGGAGCCGATCGAGGACTTCGACCTCGGCATCGACTACGCCGACCTGACGGGCGAGCCGGACCGGGAGAA
GGCGCTGCAGGAGCTCGTCAGGCACAACCGCGGCCTCGAGATGAACGTCGAGGGCGGCGAGGTGGCGACCTACTG
CCTGGCCAAGCTGGGCGAGGAGGACTGGGCCATCGTCGGCATGAACCACCACATCTCCATCGACCGCGCCAGCCT
GTTCCCCATGATGTCGCAGTTCGTGGCCGTCTACGACGCCATCCGCACGGGCCAGGACCTCGCGACCGTCTCGGC
GCCCGAGTTCAGCTACGTCGACTTCACGCTCTGGCACAACGCCCGCCTCGCCTCGGACCTGATGAAGCCCGACCT
CGCGTGGTGGCGCTCGACGCTGCAGGGCCTGCCGCAGTCGAGCAAGGTGCTGCCCTTCGCCAAGGGCGAGCGGCC
CGTCCGCAGCGACCCGCGCCGGCGCAAGGTCAAGACCAACCTGGACGCGAAGCTGTTTTCGCGCATGAAGCGCAT
CGCCGCCCAGTCCAACGGGACGCCCTTCCACTTCGTCCTGGCCGCCTTCAGGGCCTTCATCTACCGCCACACCGA
GGAGAAGGACCTGGTGCTGCTCGTCGTGGACGGCAGCAGGCCTCACCCGGACACGGACCCGCTGATGGGCTTCTT
CGTCAACCTGGCCCCCGTCCGCTGCAATGGTAAGTCGAGAAAGAGAAGAGAGGATATTGTGTCTGGATTTATCCG
AGCCCGCTTGCTGACTTTTGGTGCAAAACTACAAGACGACTGCGACGTGTCCTTCGACCAGCTCTTCCAGATCAC
CAAGGCGCGCGCCCTGGACGCCATGGCGCACAGCGGCGTGCCCTTCGACACCATCGTCGACATGATGAACGTCAA
GAAGACGAGCAGCCACATGCCGGTCGGGCAGATCGCCGTCAACTACCAGATCCACGGCCCCGTGCCGACGTACCA
GACGGTCGACTTCGTGGTGGAGGACATCGAGTCCGACGACATCCCCACCGCCGCCGACATCCAGCTCGAGGCCAT
CGAGACGTCGGAGCACAGCCTCGACTTCAAGGTCGAGTACTCGACGGCGCTCTACCACGACGCCGACATGGAGCG
CTTCCTCGACAACTTCAACACCTTCCTCGCCAGCTGCATCCAGGACCACCGCCAGCCCGTCGACGAGATCAACAT
GTGCGGCGCGCTCGAGACGGACCTGCTGAGGCGGCAGTACTGGAACACGGAGACCAGGGAGAACCAGTGGGGCGA
GGACAGCGTGCTCGACGTGATCTCCAAGATGGCAAGACAACACCCCCACGCCACGGCGATAAAAACTTCTGACGG
CTGCAGCGTATCCTACAGGCGGCTGGTAGAGCGCGCCGAGGGCGTGGCCTCTGAGCTGCTCGACGCCGGCGCCGC
GCCGGGGGGGCGGATCGGGCTCGTCGCCCTCCCCGGCGCTGAGGCCGTGGCCGGCATGCTGGGGGCGCTGATGAC
GGGCTCCGGCTACGTCGCGCTCGACCCCGACTTCGCCCACGACCGCCTCTCCTTCATGCTGGCCGACTCCGGCGC
CGGCCTCCTCCTCGTCGGGCCGGGACAGGAGGCCCTGGCCGCCGAACTCGTCTCGAAAACCGCCAACCCCCCAAA
AGTCATCGGGATCGAGGACGCGGCCGCGACGGGCCGGACCGTGGCTCGGCCGCGCGCCCGCCATCCGGATGACCC
GTTCTACATGATTTATACGTCGGTGAGTGGAACCAAGCCCGGGCACAAGGAAGCAAGCGGCCCGATCTGACTGAC
GGCGGCGCGGGAACAGGGAAGCACGGGCACGCCCAAGGGCGTGGTGCTCAAGGAGTCCAACACACAAGCGATGCT
GAGCACGCTCAACAAGGACTACGGCTTCTCGGCCAGCGACAAGTTCCTGGCGCACACGACCATGTCCTTCGACCT
CTCCATCGTCCAGATCTTCTCGGGCCTGACGGCCGGCGCCACCGTCTCGGTCGCCTCGTGGGAGACGCGCAAGGA
CCCGGCGGCCCTGGCCGACTTCATGATGGCCGAGGGCGTCTCCGTCACCTACTTCACCCCGACGCAGTTCTCGCT
CCTGATGGAGGTCAACGCGGAGGCGCTCCGCAAGTGCTCCGACTACCGGGTCGCCTACTTCGCCGGCGAGCGGCT
CCCGGTGCGCGTCGCCAGGGCCTTCTACGACCTGGGCACGCCCGCGACCCTGTACAACACGTGGTCGCCGTCGGA
GCTGGTGGTGCAGACGTCCATCGCCAAGATCGGCTACCCCGAGGAGGGCGTCGTCAGCCTGCCGATCGGGTACCC
GATGGACAACTGCCGCCACTACCTGCTCGACGGCCGGGGCAGGCCGGTGCCGCGGGGCCAGATCGGCGAGCTGGC
CGTGGGCGGCGCCCAGGTCGGGGCCGGCTACCTCAACCGGCCCGAGGCCAACGCGCGGTCCTTCGTCGAGGACCC
GTTCGCGTCGGACGAGGACCGCGCGCGCGGCTGGGGCACCATGTTCAAGACGGGCGACCGTGGCCGGTTCCGGCC
CGACGGACAACTCGAGTTCCACGGCCGCATCGCCGGCGACAAGCAGATCAAGCTGCGCGGCTTCCGCATCGACCT
CGGCGAGGTCGAGCAGGTCATCTTCAAGGAGTCGCAGGGCCTGAGGAGGGCGGGCGCGCTCGTCGACGTGGCCGT
GGTGGCGCGCGCCGTCGCCGGCGGCCCGGACGAGGAGCAGCAGCTCGTGGCGTACCTGGTGCCCAAGGCGGCCGG
CGTGACGGAGGAGGCCGACAGGGCGGCCCTGGTCTCGCAGCTGCACCGAAGGATCAAGCCGCGCCTCAACCACTA
CATGCTGCCCAACGGCTACCAGTTCCTCGACAAGCTGCCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail