Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7795
Gene name
LocationContig_474:1239..2450
Strand-
Gene length (bp)1211
Transcript length (bp)1098
Coding sequence length (bp)1098
Protein length (aa) 366

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03151 TPT Triose-phosphate Transporter family 6.0E-33 59 342

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SFE9|GONS5_ARATH GDP-mannose transporter GONST5 OS=Arabidopsis thaliana GN=GONST5 PE=2 SV=1 58 341 2.0E-20
sp|Q9LDH3|PT112_ARATH Probable sugar phosphate/phosphate translocator At1g12500 OS=Arabidopsis thaliana GN=At1g12500 PE=1 SV=1 58 349 2.0E-20
sp|Q9C521|UGAL1_ARATH UDP-galactose transporter 1 OS=Arabidopsis thaliana GN=UDP-GALT1 PE=2 SV=1 58 341 4.0E-19
sp|Q6DBP3|PT505_ARATH Probable sugar phosphate/phosphate translocator At5g05820 OS=Arabidopsis thaliana GN=At5g05820 PE=2 SV=1 71 350 3.0E-18
sp|Q3E6T0|PT525_ARATH Probable sugar phosphate/phosphate translocator At5g25400 OS=Arabidopsis thaliana GN=At5g25400 PE=2 SV=1 54 363 5.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SFE9|GONS5_ARATH GDP-mannose transporter GONST5 OS=Arabidopsis thaliana GN=GONST5 PE=2 SV=1 58 341 2.0E-20
sp|Q9LDH3|PT112_ARATH Probable sugar phosphate/phosphate translocator At1g12500 OS=Arabidopsis thaliana GN=At1g12500 PE=1 SV=1 58 349 2.0E-20
sp|Q9C521|UGAL1_ARATH UDP-galactose transporter 1 OS=Arabidopsis thaliana GN=UDP-GALT1 PE=2 SV=1 58 341 4.0E-19
sp|Q6DBP3|PT505_ARATH Probable sugar phosphate/phosphate translocator At5g05820 OS=Arabidopsis thaliana GN=At5g05820 PE=2 SV=1 71 350 3.0E-18
sp|Q3E6T0|PT525_ARATH Probable sugar phosphate/phosphate translocator At5g25400 OS=Arabidopsis thaliana GN=At5g25400 PE=2 SV=1 54 363 5.0E-18
sp|Q5XF09|PT311_ARATH Probable sugar phosphate/phosphate translocator At3g11320 OS=Arabidopsis thaliana GN=At3g11320 PE=2 SV=1 71 349 1.0E-16
sp|Q9LFN3|PT511_ARATH Probable sugar phosphate/phosphate translocator At5g11230 OS=Arabidopsis thaliana GN=At5g11230 PE=2 SV=1 53 347 1.0E-14
sp|Q8H184|PT106_ARATH Probable sugar phosphate/phosphate translocator At1g06470 OS=Arabidopsis thaliana GN=At1g06470 PE=2 SV=1 17 364 2.0E-14
sp|Q9LF61|XPT_ARATH Xylulose 5-phosphate/phosphate translocator, chloroplastic OS=Arabidopsis thaliana GN=XPT PE=1 SV=1 59 350 2.0E-14
sp|Q9SS40|PT310_ARATH Probable sugar phosphate/phosphate translocator At3g10290 OS=Arabidopsis thaliana GN=At3g10290 PE=3 SV=1 6 345 4.0E-14
sp|P21727|TPT_PEA Triose phosphate/phosphate translocator, chloroplastic OS=Pisum sativum PE=1 SV=1 61 354 4.0E-14
sp|Q9SKJ7|PT225_ARATH Probable sugar phosphate/phosphate translocator At2g25520 OS=Arabidopsis thaliana GN=At2g25520 PE=1 SV=1 56 363 5.0E-14
sp|P52177|TPT1_BRAOB Triose phosphate/phosphate translocator, chloroplastic OS=Brassica oleracea var. botrytis GN=TPT PE=2 SV=1 55 354 5.0E-14
sp|Q9ZSR7|TPT_ARATH Triose phosphate/phosphate translocator TPT, chloroplastic OS=Arabidopsis thaliana GN=TPT PE=1 SV=1 9 354 5.0E-14
sp|Q84QU8|PPT2_ORYSJ Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT2 PE=2 SV=1 13 353 6.0E-14
sp|Q94B38|GPT2_ARATH Glucose-6-phosphate/phosphate translocator 2, chloroplastic OS=Arabidopsis thaliana GN=GPT2 PE=2 SV=2 11 345 3.0E-13
sp|Q9M5A9|GPT1_ARATH Glucose-6-phosphate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana GN=GPT1 PE=2 SV=1 6 346 3.0E-13
sp|Q9SUV2|PT432_ARATH Probable sugar phosphate/phosphate translocator At4g32390 OS=Arabidopsis thaliana GN=At4g32390 PE=3 SV=1 56 355 4.0E-13
sp|Q9FYE5|PT504_ARATH Probable sugar phosphate/phosphate translocator At5g04160 OS=Arabidopsis thaliana GN=At5g04160 PE=2 SV=1 71 345 2.0E-12
sp|P11869|TPT_SPIOL Triose phosphate/phosphate translocator, chloroplastic OS=Spinacia oleracea PE=1 SV=1 9 356 4.0E-12
sp|Q8H0T6|PPT2_ARATH Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Arabidopsis thaliana GN=PPT2 PE=2 SV=1 60 345 1.0E-11
sp|Q69VR7|PPT1_ORYSJ Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT1 PE=2 SV=1 60 352 2.0E-11
sp|Q6PGC7|S35E3_MOUSE Solute carrier family 35 member E3 OS=Mus musculus GN=Slc35e3 PE=2 SV=1 127 364 2.0E-11
sp|P29463|TPT_SOLTU Triose phosphate/phosphate translocator, chloroplastic OS=Solanum tuberosum GN=TPT PE=2 SV=1 62 355 3.0E-11
sp|Q9FTT3|TPT_ORYSJ Triose phosphate/phosphate translocator TPT, chloroplastic OS=Oryza sativa subsp. japonica GN=TPT PE=2 SV=1 11 351 5.0E-11
sp|P49132|TPT_FLATR Triose phosphate/phosphate translocator, chloroplastic OS=Flaveria trinervia GN=TPT PE=2 SV=1 7 352 1.0E-10
sp|Q1JQ66|S35E3_DANRE Solute carrier family 35 member E3 OS=Danio rerio GN=slc35e3 PE=2 SV=1 66 352 1.0E-10
sp|P49131|TPT_FLAPR Triose phosphate/phosphate translocator, chloroplastic OS=Flaveria pringlei GN=TPT PE=2 SV=1 9 351 1.0E-10
sp|Q5VQL3|PPT3_ORYSJ Phosphoenolpyruvate/phosphate translocator 3, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT3 PE=2 SV=1 62 351 2.0E-10
sp|Q550W6|FUCT1_DICDI GDP-fucose transporter 1 OS=Dictyostelium discoideum GN=slc35c1 PE=3 SV=1 62 351 3.0E-10
sp|P49133|TPT_MAIZE Triose phosphate/phosphate translocator, chloroplastic OS=Zea mays GN=TPT PE=1 SV=1 62 352 4.0E-10
sp|O94695|YG1B_SCHPO Putative transporter C83.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC83.11 PE=1 SV=2 137 348 5.0E-10
sp|Q96K37|S35E1_HUMAN Solute carrier family 35 member E1 OS=Homo sapiens GN=SLC35E1 PE=1 SV=2 134 354 5.0E-10
sp|Q8RXL8|Y1689_ARATH Uncharacterized membrane protein At1g06890 OS=Arabidopsis thaliana GN=At1g06890 PE=1 SV=1 80 363 6.0E-10
sp|Q8CD26|S35E1_MOUSE Solute carrier family 35 member E1 OS=Mus musculus GN=Slc35e1 PE=1 SV=2 134 354 6.0E-10
sp|A4IFK2|S35E3_BOVIN Solute carrier family 35 member E3 OS=Bos taurus GN=SLC35E3 PE=2 SV=1 66 364 7.0E-10
sp|P0CK96|S352B_HUMAN Solute carrier family 35 member E2B OS=Homo sapiens GN=SLC35E2B PE=2 SV=1 58 350 8.0E-10
sp|Q8C811|S35E2_MOUSE Solute carrier family 35 member E2 OS=Mus musculus GN=Slc35e2 PE=2 SV=1 52 365 1.0E-09
sp|P0C6B1|S35E1_RAT Solute carrier family 35 member E1 OS=Rattus norvegicus GN=Slc35e1 PE=3 SV=1 134 354 2.0E-09
sp|Q9NQQ7|S35C2_HUMAN Solute carrier family 35 member C2 OS=Homo sapiens GN=SLC35C2 PE=1 SV=2 62 361 3.0E-09
sp|Q9VR50|S35E1_DROME Solute carrier family 35 member E1 homolog OS=Drosophila melanogaster GN=CG14621 PE=2 SV=1 74 345 5.0E-09
sp|Q7Z769|S35E3_HUMAN Solute carrier family 35 member E3 OS=Homo sapiens GN=SLC35E3 PE=2 SV=1 127 364 2.0E-08
sp|P52178|TPT2_BRAOB Triose phosphate/phosphate translocator, non-green plastid, chloroplastic OS=Brassica oleracea var. botrytis GN=NGTPT PE=2 SV=1 62 220 2.0E-08
sp|Q5RKL7|S35E4_RAT Solute carrier family 35 member E4 OS=Rattus norvegicus GN=Slc35e4 PE=2 SV=1 73 355 4.0E-08
sp|Q9C8M1|PT153_ARATH Probable sugar phosphate/phosphate translocator At1g53660 OS=Arabidopsis thaliana GN=At1g53660 PE=3 SV=2 72 365 5.0E-08
sp|Q10354|YDB1_SCHPO Uncharacterized transporter C22E12.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22E12.01 PE=3 SV=2 62 352 9.0E-08
sp|Q6ICL7|S35E4_HUMAN Solute carrier family 35 member E4 OS=Homo sapiens GN=SLC35E4 PE=2 SV=1 73 358 9.0E-08
sp|Q8RXN3|PPT1_ARATH Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana GN=PPT1 PE=1 SV=1 62 199 2.0E-07
sp|Q8K3D6|S35E4_MOUSE Solute carrier family 35 member E4 OS=Mus musculus GN=Slc35e4 PE=2 SV=2 123 355 3.0E-07
sp|Q5M8T2|S35D3_HUMAN Solute carrier family 35 member D3 OS=Homo sapiens GN=SLC35D3 PE=2 SV=1 80 365 1.0E-06
sp|Q8VCX2|S35C2_MOUSE Solute carrier family 35 member C2 OS=Mus musculus GN=Slc35c2 PE=1 SV=1 62 355 2.0E-06
sp|Q9LNH5|PT148_ARATH Probable sugar phosphate/phosphate translocator At1g48230 OS=Arabidopsis thaliana GN=At1g48230 PE=2 SV=2 71 350 4.0E-06
sp|Q9SRE4|UGAL2_ARATH UDP-galactose transporter 2 OS=Arabidopsis thaliana GN=UDP-GALT2 PE=2 SV=1 80 352 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 58 80 22
2 85 107 22
3 119 141 22
4 146 165 19
5 172 189 17
6 193 215 22
7 236 255 19
8 265 287 22
9 294 316 22
10 321 342 21

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7795
MARRSGDGPVPLLTPEEQDRGSKAELGDVESDAGSEELPPNQNLDHEYSIPSTVKFTWLGTYFFFSLLLTLYNKL
VLGMFSFPWLLTCLHASFASLGTCVMMHMGHFKLSRLGRRENMALVAFSALFTANIALSNLSLAMVSVPFYQTMR
MLCPIFTICIYRVWYSRTYSAMTYLSLMPLIVGAAMTTAGEMTFTDAGFLLTILGVVLAAVKTVVTNRFMTGSLA
LPPVEFVMRMSPLAALQALACATVTGEVAGFRDLISSGNISIAPAVASLAGNGFLAFLLNIASFQTNKLAGALTM
TVCGNLKQCLTVLIGIFMFKISVDMLNGAGMAVTMFGAAIYSKAELDNKKKRGQGTYQAVEQKPR*
Coding >Hirsu2|7795
ATGGCTCGCCGCAGCGGCGATGGACCCGTACCCCTCCTGACGCCCGAGGAGCAGGATCGTGGGTCCAAGGCCGAG
CTGGGCGATGTCGAAAGCGACGCCGGCTCCGAAGAGCTCCCACCCAACCAAAACCTCGACCACGAGTACTCGATA
CCCAGCACCGTCAAGTTCACCTGGCTCGGCACATACTTCTTCTTTTCCCTGCTCCTTACCCTCTACAACAAGCTG
GTCCTGGGCATGTTCTCCTTTCCCTGGCTCCTCACCTGTCTCCACGCCTCCTTCGCCAGCCTGGGCACCTGCGTC
ATGATGCATATGGGTCATTTCAAGCTGTCGCGCCTGGGACGCCGCGAGAACATGGCCCTCGTCGCCTTCAGCGCC
CTCTTCACCGCCAACATTGCCCTCTCGAACCTGTCTCTGGCCATGGTGTCGGTGCCGTTCTACCAGACGATGCGC
ATGCTGTGCCCCATATTCACCATCTGCATCTACCGGGTCTGGTACAGCCGCACGTACAGCGCCATGACGTACCTG
TCGCTGATGCCTCTCATCGTCGGCGCGGCCATGACGACCGCCGGCGAGATGACGTTTACCGACGCCGGCTTCCTC
CTCACCATACTCGGCGTCGTCCTCGCCGCCGTCAAGACGGTCGTGACGAACCGGTTCATGACGGGATCGCTGGCG
CTGCCTCCGGTGGAATTCGTGATGCGCATGTCCCCCCTGGCGGCGCTGCAAGCCCTGGCGTGCGCCACGGTGACG
GGCGAGGTGGCCGGGTTCCGGGATCTCATATCGTCGGGGAACATTTCGATTGCTCCGGCGGTTGCCTCGCTGGCC
GGCAACGGCTTCCTCGCCTTCCTGCTCAACATTGCGTCCTTTCAAACGAACAAGCTGGCGGGCGCGCTGACGATG
ACGGTGTGCGGCAACCTGAAGCAGTGCCTGACGGTGCTGATCGGCATCTTCATGTTCAAGATCTCGGTCGACATG
CTCAACGGCGCGGGCATGGCGGTGACGATGTTCGGGGCGGCCATCTACAGCAAGGCGGAGCTGGACAACAAGAAG
AAGCGCGGGCAAGGGACGTACCAGGCGGTGGAGCAGAAGCCGAGGTAG
Transcript >Hirsu2|7795
ATGGCTCGCCGCAGCGGCGATGGACCCGTACCCCTCCTGACGCCCGAGGAGCAGGATCGTGGGTCCAAGGCCGAG
CTGGGCGATGTCGAAAGCGACGCCGGCTCCGAAGAGCTCCCACCCAACCAAAACCTCGACCACGAGTACTCGATA
CCCAGCACCGTCAAGTTCACCTGGCTCGGCACATACTTCTTCTTTTCCCTGCTCCTTACCCTCTACAACAAGCTG
GTCCTGGGCATGTTCTCCTTTCCCTGGCTCCTCACCTGTCTCCACGCCTCCTTCGCCAGCCTGGGCACCTGCGTC
ATGATGCATATGGGTCATTTCAAGCTGTCGCGCCTGGGACGCCGCGAGAACATGGCCCTCGTCGCCTTCAGCGCC
CTCTTCACCGCCAACATTGCCCTCTCGAACCTGTCTCTGGCCATGGTGTCGGTGCCGTTCTACCAGACGATGCGC
ATGCTGTGCCCCATATTCACCATCTGCATCTACCGGGTCTGGTACAGCCGCACGTACAGCGCCATGACGTACCTG
TCGCTGATGCCTCTCATCGTCGGCGCGGCCATGACGACCGCCGGCGAGATGACGTTTACCGACGCCGGCTTCCTC
CTCACCATACTCGGCGTCGTCCTCGCCGCCGTCAAGACGGTCGTGACGAACCGGTTCATGACGGGATCGCTGGCG
CTGCCTCCGGTGGAATTCGTGATGCGCATGTCCCCCCTGGCGGCGCTGCAAGCCCTGGCGTGCGCCACGGTGACG
GGCGAGGTGGCCGGGTTCCGGGATCTCATATCGTCGGGGAACATTTCGATTGCTCCGGCGGTTGCCTCGCTGGCC
GGCAACGGCTTCCTCGCCTTCCTGCTCAACATTGCGTCCTTTCAAACGAACAAGCTGGCGGGCGCGCTGACGATG
ACGGTGTGCGGCAACCTGAAGCAGTGCCTGACGGTGCTGATCGGCATCTTCATGTTCAAGATCTCGGTCGACATG
CTCAACGGCGCGGGCATGGCGGTGACGATGTTCGGGGCGGCCATCTACAGCAAGGCGGAGCTGGACAACAAGAAG
AAGCGCGGGCAAGGGACGTACCAGGCGGTGGAGCAGAAGCCGAGGTAG
Gene >Hirsu2|7795
ATGGCTCGCCGCAGCGGCGATGGACCCGTACCCCTCCTGACGCCCGAGGAGCAGGATCGTGGGTCCAAGGCCGAG
CTGGGCGATGTCGAAAGCGACGCCGGCTCCGAAGAGCTCCCACCCAACCAAAACCTCGACCACGAGTACTCGATA
CCCAGCACCGTCAAGTTCACCTGGCTCGGCACATACTTCTTCTTTTCCCTGCTCCTTACCCTCTACAACAAGCTG
GTCCTGGGCATGGTGAGTCCCGCCTGATCGCGACCCAAGTTCGTCGGCTTACGTCGGCGTCTCCGCCCCGGCAGT
TCTCCTTTCCCTGGCTCCTCACCTGTCTCCACGCCTCCTTCGCCAGCCTGGGCACCTGCGTCATGATGCATATGG
GTCATTTCAAGCTGTCGCGCCTGGGACGCCGCGAGAACATGGCCCTCGTCGCCTTCAGCGCCCTCTTCACCGCCA
ACATTGCCCTCTCGAACCTGTCTCTGGCCATGGTGTCGGTGCCGTTCTACCAGACGATGCGCATGCTGTGCCCCA
TATTCACCATCTGCATCTACCGGGTCTGGTACAGCCGCACGTACAGCGCCATGACGTACCTGTCGCTGATGCCTC
TCATCGTCGGCGCGGCCATGACGACCGCCGGCGAGATGACGTTTACCGACGCCGGCTTCCTCCTCACCATACTCG
GCGTCGTCCTCGCCGCCGTCAAGGTACGTTTTGACCGTGCGCCGCTCCCAAAGGAGCCCGACTGACGGGTGCAGA
CGGTCGTGACGAACCGGTTCATGACGGGATCGCTGGCGCTGCCTCCGGTGGAATTCGTGATGCGCATGTCCCCCC
TGGCGGCGCTGCAAGCCCTGGCGTGCGCCACGGTGACGGGCGAGGTGGCCGGGTTCCGGGATCTCATATCGTCGG
GGAACATTTCGATTGCTCCGGCGGTTGCCTCGCTGGCCGGCAACGGCTTCCTCGCCTTCCTGCTCAACATTGCGT
CCTTTCAAACGAACAAGCTGGCGGGCGCGCTGACGATGACGGTGTGCGGCAACCTGAAGCAGTGCCTGACGGTGC
TGATCGGCATCTTCATGTTCAAGATCTCGGTCGACATGCTCAACGGCGCGGGCATGGCGGTGACGATGTTCGGGG
CGGCCATCTACAGCAAGGCGGAGCTGGACAACAAGAAGAAGCGCGGGCAAGGGACGTACCAGGCGGTGGAGCAGA
AGCCGAGGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail