Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7793
Gene name
LocationContig_473:13282..14746
Strand-
Gene length (bp)1464
Transcript length (bp)1464
Coding sequence length (bp)1464
Protein length (aa) 488

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 4.6E-11 93 253
PF12146 Hydrolase_4 Serine aminopeptidase, S33 3.2E-08 118 219

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P46547|PIP_AERSO Proline iminopeptidase OS=Aeromonas sobria GN=pip PE=1 SV=3 16 485 6.0E-91

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6245 0.2946 0.3178 0.1515 0.2886 0.0709 0.2141 0.2486 0.123 0.0339

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3913
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6082
Ophiocordyceps australis map64 (Brazil) OphauB2|7664
Ophiocordyceps camponoti-floridani Ophcf2|00407
Ophiocordyceps camponoti-rufipedis Ophun1|5340
Ophiocordyceps kimflemingae Ophio5|6351
Ophiocordyceps subramaniannii Hirsu2|7793 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7793
MASAAAAVEVPPAKLVSATNHVVPGQLLVTELFFRVPLDYADPAAGSITLFGRRASKRERPVFPPDADRDEAEAE
ADDDDDDDDGKPPPKPYMVYLEGGPGFGNREPQDHPLTRTALSRGYQVLYLDHRGVGLSTPVSAAMLARLGDADA
QARYMRLMRQDNTVRDCEAVRRCLTAGWPAAKAAWSIFGQSYGGFVALSYLSMHPRGLREVFLTGGLAPVGRSPE
HVYQATFRRTADRNRRYFDKFPEDAAVLRRLAAHLDAQGGAVPLPAGGCLTLPRLLTSGIAFGGHGGFDSVHNLL
LHLDASLDQFGFLARPALQPLETFTSFDTNIIYALLHEAIYCDGPGRASDWAAYRVGRALEPFSWLDPDRAARPD
RTPYFSGEMIFPLHFETYPELIPLRDLAEKLAATDDWPRLYDEQQLRNNSVPVYAVSYVEDMYVDYDFARDTARL
VRGTKVAETNLMYHSALRAKADEVMQMLFSLRDDVLD*
Coding >Hirsu2|7793
ATGGCCTCCGCCGCCGCCGCCGTCGAGGTGCCGCCGGCGAAGCTGGTCAGCGCCACCAACCACGTCGTGCCCGGC
CAGCTGCTCGTCACCGAGCTCTTCTTCCGCGTGCCGCTCGACTACGCCGACCCGGCGGCCGGCTCCATCACGCTG
TTCGGCCGCCGCGCGTCGAAGCGCGAGCGGCCCGTCTTCCCCCCGGACGCGGACCGTGACGAGGCCGAGGCCGAG
GCCGACGACGACGACGACGACGACGACGGCAAGCCGCCGCCCAAGCCCTACATGGTCTACCTCGAGGGCGGCCCG
GGCTTCGGCAACCGCGAGCCGCAGGACCACCCGCTCACCCGCACCGCCCTCTCGCGCGGCTACCAGGTGCTGTAC
CTGGACCACCGCGGCGTCGGCCTCAGCACGCCCGTGTCGGCCGCCATGCTGGCCCGCCTGGGCGACGCCGACGCC
CAGGCCCGCTACATGCGCCTGATGCGCCAGGACAACACGGTCCGCGACTGCGAGGCCGTCCGCCGCTGCCTGACG
GCCGGCTGGCCCGCCGCCAAGGCCGCCTGGTCCATCTTCGGCCAGTCGTACGGCGGCTTCGTCGCCCTGTCGTAC
CTGTCCATGCACCCGCGCGGTCTGCGCGAGGTCTTCCTCACCGGCGGCCTGGCCCCCGTCGGCCGCTCGCCCGAG
CACGTCTACCAGGCCACCTTCCGCCGCACGGCCGACCGCAACCGCCGCTACTTCGACAAGTTCCCCGAGGACGCG
GCCGTCCTGCGCCGCCTCGCCGCCCACCTCGACGCCCAGGGCGGCGCCGTGCCCCTGCCCGCCGGCGGCTGCCTG
ACCCTGCCGCGCCTGCTGACGTCGGGCATCGCCTTCGGCGGCCACGGCGGCTTCGACAGCGTCCACAACCTGCTG
CTCCACCTCGACGCCTCGCTCGACCAGTTCGGCTTCCTGGCCCGGCCCGCGCTGCAGCCGCTCGAGACCTTCACC
TCCTTCGACACCAACATCATCTACGCCCTGCTGCACGAGGCCATCTACTGCGACGGGCCCGGCCGCGCCTCCGAC
TGGGCCGCCTACCGCGTCGGCCGCGCCCTCGAGCCCTTCTCCTGGCTCGACCCCGACCGCGCCGCCCGCCCCGAC
CGGACGCCCTACTTCTCGGGCGAGATGATCTTCCCCCTCCACTTCGAGACGTACCCGGAGCTCATCCCCCTGCGC
GACCTGGCCGAGAAGCTGGCCGCGACCGACGACTGGCCGCGCCTGTACGACGAGCAGCAGCTGCGCAACAATTCC
GTCCCCGTCTACGCCGTCTCGTACGTCGAGGACATGTACGTCGACTACGACTTCGCCCGCGACACGGCCCGCCTC
GTCAGGGGCACCAAGGTGGCCGAGACCAACCTCATGTACCACTCGGCCCTGCGCGCCAAGGCCGACGAGGTGATG
CAGATGCTGTTCAGCCTCCGGGACGATGTCCTCGACTGA
Transcript >Hirsu2|7793
ATGGCCTCCGCCGCCGCCGCCGTCGAGGTGCCGCCGGCGAAGCTGGTCAGCGCCACCAACCACGTCGTGCCCGGC
CAGCTGCTCGTCACCGAGCTCTTCTTCCGCGTGCCGCTCGACTACGCCGACCCGGCGGCCGGCTCCATCACGCTG
TTCGGCCGCCGCGCGTCGAAGCGCGAGCGGCCCGTCTTCCCCCCGGACGCGGACCGTGACGAGGCCGAGGCCGAG
GCCGACGACGACGACGACGACGACGACGGCAAGCCGCCGCCCAAGCCCTACATGGTCTACCTCGAGGGCGGCCCG
GGCTTCGGCAACCGCGAGCCGCAGGACCACCCGCTCACCCGCACCGCCCTCTCGCGCGGCTACCAGGTGCTGTAC
CTGGACCACCGCGGCGTCGGCCTCAGCACGCCCGTGTCGGCCGCCATGCTGGCCCGCCTGGGCGACGCCGACGCC
CAGGCCCGCTACATGCGCCTGATGCGCCAGGACAACACGGTCCGCGACTGCGAGGCCGTCCGCCGCTGCCTGACG
GCCGGCTGGCCCGCCGCCAAGGCCGCCTGGTCCATCTTCGGCCAGTCGTACGGCGGCTTCGTCGCCCTGTCGTAC
CTGTCCATGCACCCGCGCGGTCTGCGCGAGGTCTTCCTCACCGGCGGCCTGGCCCCCGTCGGCCGCTCGCCCGAG
CACGTCTACCAGGCCACCTTCCGCCGCACGGCCGACCGCAACCGCCGCTACTTCGACAAGTTCCCCGAGGACGCG
GCCGTCCTGCGCCGCCTCGCCGCCCACCTCGACGCCCAGGGCGGCGCCGTGCCCCTGCCCGCCGGCGGCTGCCTG
ACCCTGCCGCGCCTGCTGACGTCGGGCATCGCCTTCGGCGGCCACGGCGGCTTCGACAGCGTCCACAACCTGCTG
CTCCACCTCGACGCCTCGCTCGACCAGTTCGGCTTCCTGGCCCGGCCCGCGCTGCAGCCGCTCGAGACCTTCACC
TCCTTCGACACCAACATCATCTACGCCCTGCTGCACGAGGCCATCTACTGCGACGGGCCCGGCCGCGCCTCCGAC
TGGGCCGCCTACCGCGTCGGCCGCGCCCTCGAGCCCTTCTCCTGGCTCGACCCCGACCGCGCCGCCCGCCCCGAC
CGGACGCCCTACTTCTCGGGCGAGATGATCTTCCCCCTCCACTTCGAGACGTACCCGGAGCTCATCCCCCTGCGC
GACCTGGCCGAGAAGCTGGCCGCGACCGACGACTGGCCGCGCCTGTACGACGAGCAGCAGCTGCGCAACAATTCC
GTCCCCGTCTACGCCGTCTCGTACGTCGAGGACATGTACGTCGACTACGACTTCGCCCGCGACACGGCCCGCCTC
GTCAGGGGCACCAAGGTGGCCGAGACCAACCTCATGTACCACTCGGCCCTGCGCGCCAAGGCCGACGAGGTGATG
CAGATGCTGTTCAGCCTCCGGGACGATGTCCTCGACTGA
Gene >Hirsu2|7793
ATGGCCTCCGCCGCCGCCGCCGTCGAGGTGCCGCCGGCGAAGCTGGTCAGCGCCACCAACCACGTCGTGCCCGGC
CAGCTGCTCGTCACCGAGCTCTTCTTCCGCGTGCCGCTCGACTACGCCGACCCGGCGGCCGGCTCCATCACGCTG
TTCGGCCGCCGCGCGTCGAAGCGCGAGCGGCCCGTCTTCCCCCCGGACGCGGACCGTGACGAGGCCGAGGCCGAG
GCCGACGACGACGACGACGACGACGACGGCAAGCCGCCGCCCAAGCCCTACATGGTCTACCTCGAGGGCGGCCCG
GGCTTCGGCAACCGCGAGCCGCAGGACCACCCGCTCACCCGCACCGCCCTCTCGCGCGGCTACCAGGTGCTGTAC
CTGGACCACCGCGGCGTCGGCCTCAGCACGCCCGTGTCGGCCGCCATGCTGGCCCGCCTGGGCGACGCCGACGCC
CAGGCCCGCTACATGCGCCTGATGCGCCAGGACAACACGGTCCGCGACTGCGAGGCCGTCCGCCGCTGCCTGACG
GCCGGCTGGCCCGCCGCCAAGGCCGCCTGGTCCATCTTCGGCCAGTCGTACGGCGGCTTCGTCGCCCTGTCGTAC
CTGTCCATGCACCCGCGCGGTCTGCGCGAGGTCTTCCTCACCGGCGGCCTGGCCCCCGTCGGCCGCTCGCCCGAG
CACGTCTACCAGGCCACCTTCCGCCGCACGGCCGACCGCAACCGCCGCTACTTCGACAAGTTCCCCGAGGACGCG
GCCGTCCTGCGCCGCCTCGCCGCCCACCTCGACGCCCAGGGCGGCGCCGTGCCCCTGCCCGCCGGCGGCTGCCTG
ACCCTGCCGCGCCTGCTGACGTCGGGCATCGCCTTCGGCGGCCACGGCGGCTTCGACAGCGTCCACAACCTGCTG
CTCCACCTCGACGCCTCGCTCGACCAGTTCGGCTTCCTGGCCCGGCCCGCGCTGCAGCCGCTCGAGACCTTCACC
TCCTTCGACACCAACATCATCTACGCCCTGCTGCACGAGGCCATCTACTGCGACGGGCCCGGCCGCGCCTCCGAC
TGGGCCGCCTACCGCGTCGGCCGCGCCCTCGAGCCCTTCTCCTGGCTCGACCCCGACCGCGCCGCCCGCCCCGAC
CGGACGCCCTACTTCTCGGGCGAGATGATCTTCCCCCTCCACTTCGAGACGTACCCGGAGCTCATCCCCCTGCGC
GACCTGGCCGAGAAGCTGGCCGCGACCGACGACTGGCCGCGCCTGTACGACGAGCAGCAGCTGCGCAACAATTCC
GTCCCCGTCTACGCCGTCTCGTACGTCGAGGACATGTACGTCGACTACGACTTCGCCCGCGACACGGCCCGCCTC
GTCAGGGGCACCAAGGTGGCCGAGACCAACCTCATGTACCACTCGGCCCTGCGCGCCAAGGCCGACGAGGTGATG
CAGATGCTGTTCAGCCTCCGGGACGATGTCCTCGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail