Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7789
Gene name
LocationContig_473:1278..1843
Strand+
Gene length (bp)565
Transcript length (bp)495
Coding sequence length (bp)495
Protein length (aa) 165

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05348 UMP1 Proteasome maturation factor UMP1 2.6E-39 24 161

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38293|UMP1_YEAST Proteasome maturation factor UMP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UMP1 PE=1 SV=1 3 161 2.0E-17
sp|O74416|UMP1_SCHPO Probable proteasome maturation factor ump1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ump1 PE=3 SV=1 63 144 3.0E-15
sp|Q3SZV5|POMP_BOVIN Proteasome maturation protein OS=Bos taurus GN=POMP PE=2 SV=1 62 143 2.0E-08
sp|Q5R9L9|POMP_PONAB Proteasome maturation protein OS=Pongo abelii GN=POMP PE=2 SV=1 64 143 2.0E-08
sp|Q9Y244|POMP_HUMAN Proteasome maturation protein OS=Homo sapiens GN=POMP PE=1 SV=1 64 143 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38293|UMP1_YEAST Proteasome maturation factor UMP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UMP1 PE=1 SV=1 3 161 2.0E-17
sp|O74416|UMP1_SCHPO Probable proteasome maturation factor ump1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ump1 PE=3 SV=1 63 144 3.0E-15
sp|Q3SZV5|POMP_BOVIN Proteasome maturation protein OS=Bos taurus GN=POMP PE=2 SV=1 62 143 2.0E-08
sp|Q5R9L9|POMP_PONAB Proteasome maturation protein OS=Pongo abelii GN=POMP PE=2 SV=1 64 143 2.0E-08
sp|Q9Y244|POMP_HUMAN Proteasome maturation protein OS=Homo sapiens GN=POMP PE=1 SV=1 64 143 2.0E-08
sp|Q9CQT5|POMP_MOUSE Proteasome maturation protein OS=Mus musculus GN=Pomp PE=1 SV=1 62 143 4.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7789
MSLRIVPARENASSFSHAHTSSAPSAPGIHDTLRHGVGPSPYETCGGSGGSDGGKAAPAPPISAHPLEARLRNWE
ATRDALRMQSLRRTFGLAEPVRRGMELKMVRDGEWRPLALGSAAGLPSVHEDILRGTDDSLTWEDVFTGDDTRGL
VSFHDEMERKLKMN*
Coding >Hirsu2|7789
ATGTCGCTCCGCATCGTCCCCGCGCGCGAAAACGCCTCGTCCTTCTCCCACGCCCACACCTCGTCCGCGCCCTCG
GCCCCCGGCATCCACGACACGCTCCGCCACGGCGTCGGCCCCTCGCCCTACGAGACCTGCGGCGGCAGCGGCGGC
AGCGACGGCGGCAAGGCCGCTCCCGCGCCCCCGATCTCGGCCCACCCGCTCGAGGCCCGTCTCCGCAACTGGGAG
GCCACCCGCGACGCCCTCCGCATGCAGTCCCTCCGCCGCACCTTCGGCCTCGCCGAGCCCGTCCGCCGCGGCATG
GAGCTCAAGATGGTCCGCGACGGCGAGTGGCGGCCGCTCGCCCTCGGCTCCGCCGCCGGCCTGCCCAGCGTCCAC
GAGGACATCCTGCGCGGCACCGACGACTCGCTCACGTGGGAGGACGTCTTCACCGGCGACGACACCCGCGGCCTC
GTCTCCTTCCACGACGAGATGGAGCGGAAGCTCAAGATGAACTGA
Transcript >Hirsu2|7789
ATGTCGCTCCGCATCGTCCCCGCGCGCGAAAACGCCTCGTCCTTCTCCCACGCCCACACCTCGTCCGCGCCCTCG
GCCCCCGGCATCCACGACACGCTCCGCCACGGCGTCGGCCCCTCGCCCTACGAGACCTGCGGCGGCAGCGGCGGC
AGCGACGGCGGCAAGGCCGCTCCCGCGCCCCCGATCTCGGCCCACCCGCTCGAGGCCCGTCTCCGCAACTGGGAG
GCCACCCGCGACGCCCTCCGCATGCAGTCCCTCCGCCGCACCTTCGGCCTCGCCGAGCCCGTCCGCCGCGGCATG
GAGCTCAAGATGGTCCGCGACGGCGAGTGGCGGCCGCTCGCCCTCGGCTCCGCCGCCGGCCTGCCCAGCGTCCAC
GAGGACATCCTGCGCGGCACCGACGACTCGCTCACGTGGGAGGACGTCTTCACCGGCGACGACACCCGCGGCCTC
GTCTCCTTCCACGACGAGATGGAGCGGAAGCTCAAGATGAACTGA
Gene >Hirsu2|7789
ATGGTAAGTCAACCCTCAATCCGACGAGCGGCGTCAATGCTTCTCTCCTCTTCCCTTTCTCAACATCAAACAGTC
GCTCCGCATCGTCCCCGCGCGCGAAAACGCCTCGTCCTTCTCCCACGCCCACACCTCGTCCGCGCCCTCGGCCCC
CGGCATCCACGACACGCTCCGCCACGGCGTCGGCCCCTCGCCCTACGAGACCTGCGGCGGCAGCGGCGGCAGCGA
CGGCGGCAAGGCCGCTCCCGCGCCCCCGATCTCGGCCCACCCGCTCGAGGCCCGTCTCCGCAACTGGGAGGCCAC
CCGCGACGCCCTCCGCATGCAGTCCCTCCGCCGCACCTTCGGCCTCGCCGAGCCCGTCCGCCGCGGCATGGAGCT
CAAGATGGTCCGCGACGGCGAGTGGCGGCCGCTCGCCCTCGGCTCCGCCGCCGGCCTGCCCAGCGTCCACGAGGA
CATCCTGCGCGGCACCGACGACTCGCTCACGTGGGAGGACGTCTTCACCGGCGACGACACCCGCGGCCTCGTCTC
CTTCCACGACGAGATGGAGCGGAAGCTCAAGATGAACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail