Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7784
Gene name
LocationContig_472:8920..11427
Strand-
Gene length (bp)2507
Transcript length (bp)2010
Coding sequence length (bp)2010
Protein length (aa) 670

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01591 6PF2K 6-phosphofructo-2-kinase 2.2E-17 142 197
PF01591 6PF2K 6-phosphofructo-2-kinase 7.6E-46 249 414
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 5.7E-23 500 644

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40433|6P21_YEAST 6-phosphofructo-2-kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFK26 PE=1 SV=1 120 658 7.0E-147
sp|Q8TFH0|YIKE_SCHPO Probable 6-phosphofructo-2-kinase PB17E12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.14c PE=1 SV=2 205 657 8.0E-127
sp|Q9UTE1|YFMD_SCHPO Probable 6-phosphofructo-2-kinase C222.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC222.13c PE=3 SV=1 120 663 2.0E-109
sp|Q21122|F2612_CAEEL 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Caenorhabditis elegans GN=pfkb-1.2 PE=3 SV=2 148 654 7.0E-83
sp|P16118|F261_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Homo sapiens GN=PFKFB1 PE=1 SV=3 117 638 6.0E-72
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40433|6P21_YEAST 6-phosphofructo-2-kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFK26 PE=1 SV=1 120 658 7.0E-147
sp|Q8TFH0|YIKE_SCHPO Probable 6-phosphofructo-2-kinase PB17E12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.14c PE=1 SV=2 205 657 8.0E-127
sp|Q9UTE1|YFMD_SCHPO Probable 6-phosphofructo-2-kinase C222.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC222.13c PE=3 SV=1 120 663 2.0E-109
sp|Q21122|F2612_CAEEL 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Caenorhabditis elegans GN=pfkb-1.2 PE=3 SV=2 148 654 7.0E-83
sp|P16118|F261_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Homo sapiens GN=PFKFB1 PE=1 SV=3 117 638 6.0E-72
sp|P70265|F262_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Mus musculus GN=Pfkfb2 PE=1 SV=2 116 638 2.0E-71
sp|P70266|F261_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Mus musculus GN=Pfkfb1 PE=1 SV=2 138 638 3.0E-71
sp|Q9JJH5|F262_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Rattus norvegicus GN=Pfkfb2 PE=1 SV=1 116 638 6.0E-71
sp|O60825|F262_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens GN=PFKFB2 PE=1 SV=2 252 647 3.0E-70
sp|Q28901|F263_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (Fragment) OS=Bos taurus GN=PFKFB3 PE=2 SV=2 148 638 7.0E-70
sp|Q5NVT1|F262_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Pongo abelii GN=PFKFB2 PE=2 SV=1 252 647 1.0E-69
sp|Q91348|F26L_CHICK 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Gallus gallus PE=2 SV=2 249 638 5.0E-69
sp|P26285|F262_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Bos taurus GN=PFKFB2 PE=1 SV=2 252 647 2.0E-68
sp|P07953|F261_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Rattus norvegicus GN=Pfkfb1 PE=1 SV=3 247 638 2.0E-67
sp|Q16875|F263_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens GN=PFKFB3 PE=1 SV=1 253 639 2.0E-67
sp|Q5R9C1|F263_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Pongo abelii GN=PFKFB3 PE=2 SV=2 253 638 2.0E-67
sp|O35552|F263_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Rattus norvegicus GN=Pfkfb3 PE=2 SV=1 253 638 2.0E-67
sp|Q91309|F26_LITCT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Lithobates catesbeiana PE=2 SV=1 216 638 5.0E-67
sp|P25114|F264_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Rattus norvegicus GN=Pfkfb4 PE=1 SV=3 252 638 1.0E-65
sp|P32604|F26_YEAST Fructose-2,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FBP26 PE=1 SV=2 127 638 7.0E-65
sp|P49872|F261_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Bos taurus GN=PFKFB1 PE=2 SV=1 247 638 4.0E-64
sp|Q6DTY7|F264_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Mus musculus GN=Pfkfb4 PE=2 SV=4 252 638 5.0E-64
sp|Q4R8B6|F264_MACFA 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Macaca fascicularis GN=PFKFB4 PE=2 SV=3 252 638 1.0E-63
sp|Q16877|F264_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Homo sapiens GN=PFKFB4 PE=2 SV=6 252 638 1.0E-63
sp|Q9MB58|F26_ARATH 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Arabidopsis thaliana GN=FKFBP PE=1 SV=1 250 645 8.0E-61
sp|Q9URZ7|YK72_SCHPO Probable fructose-2,6-bisphosphatase C732.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC732.02c PE=3 SV=1 280 637 6.0E-45
sp|Q06137|YL345_YEAST Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase YLR345W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR345W PE=1 SV=1 216 637 4.0E-30
sp|Q8TFH0|YIKE_SCHPO Probable 6-phosphofructo-2-kinase PB17E12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.14c PE=1 SV=2 20 190 2.0E-13
sp|Q9MB58|F26_ARATH 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Arabidopsis thaliana GN=FKFBP PE=1 SV=1 147 218 2.0E-09
sp|O35552|F263_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Rattus norvegicus GN=Pfkfb3 PE=2 SV=1 148 190 4.0E-09
sp|Q5R9C1|F263_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Pongo abelii GN=PFKFB3 PE=2 SV=2 148 190 4.0E-09
sp|Q16875|F263_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens GN=PFKFB3 PE=1 SV=1 148 190 5.0E-09
sp|Q9UTK9|YIVH_SCHPO Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase C144.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.17c PE=1 SV=2 254 422 2.0E-08
sp|Q91309|F26_LITCT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Lithobates catesbeiana PE=2 SV=1 148 190 2.0E-08
sp|P49872|F261_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Bos taurus GN=PFKFB1 PE=2 SV=1 126 193 7.0E-08
sp|P25114|F264_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Rattus norvegicus GN=Pfkfb4 PE=1 SV=3 148 219 7.0E-08
sp|P07953|F261_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Rattus norvegicus GN=Pfkfb1 PE=1 SV=3 117 193 8.0E-08
sp|Q4R8B6|F264_MACFA 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Macaca fascicularis GN=PFKFB4 PE=2 SV=3 148 188 9.0E-08
sp|Q6DTY7|F264_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Mus musculus GN=Pfkfb4 PE=2 SV=4 148 187 9.0E-08
sp|Q16877|F264_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Homo sapiens GN=PFKFB4 PE=2 SV=6 148 187 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006000 fructose metabolic process Yes
GO:0003873 6-phosphofructo-2-kinase activity Yes
GO:0005524 ATP binding Yes
GO:1901363 heterocyclic compound binding No
GO:0016301 kinase activity No
GO:1901265 nucleoside phosphate binding No
GO:0030554 adenyl nucleotide binding No
GO:0008152 metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0019318 hexose metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0032555 purine ribonucleotide binding No
GO:0008150 biological_process No
GO:0016740 transferase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0044238 primary metabolic process No
GO:0043167 ion binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0000166 nucleotide binding No
GO:0008443 phosphofructokinase activity No
GO:0043168 anion binding No
GO:0032553 ribonucleotide binding No
GO:0044281 small molecule metabolic process No
GO:0003674 molecular_function No
GO:0019200 carbohydrate kinase activity No
GO:0097367 carbohydrate derivative binding No
GO:0005996 monosaccharide metabolic process No
GO:0017076 purine nucleotide binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.752 0.4197 0.0199 0.1647 0.1971 0.0063 0.0924 0.228 0.1037 0.0052

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3907
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4122
Ophiocordyceps australis map64 (Brazil) OphauB2|7677
Ophiocordyceps camponoti-floridani Ophcf2|00493
Ophiocordyceps camponoti-rufipedis Ophun1|6505
Ophiocordyceps kimflemingae Ophio5|8196
Ophiocordyceps subramaniannii Hirsu2|7784 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7784
MPSAVVIPRQDLGRKQAKQSALAKLVMHNTLASSSPPPISPTTSEPEPQLAVLPPPSIRYGHSPSAASPAMAHAV
RIMKDLTDTPPLCQSVSSTAPSSPRIPPQRQNSGNQTPRVRPHATTLNIPGMTRSRVSPDGRIPQRDVAAKLVIV
MVGLPARGKSYITKKLQRYLSWQQHESRIFNVGNRRRHAAGIKVSAKPKLAPEPDCLDPPVQAATILLNGGPAPN
AATSLSRDCTEPTALHLDAAPDADADQSAKFFDPRNQRAAAIRDQVAMDTLDELLDYLLNLGGAVGILDATNSTI
RRRQQIVDRIRRREPKLGILFIESICRDQNLLEANMRLKLSGPDYRDKDPHKSLEDFKNRVAAYASAYEPLGEYE
EDNDMQYIQIVDVGRKLVQHRLKGFLSGGISTYLSSFNLAPRQIWITRHGQSVDNELGKLGGDSPLTERGHCYGQ
ALYNFITQRRKEWLMEQKSKMAQASFPPLPGDNTPPYPDMNRDLDEKNFCVWTSMLQRSVETAEYFDVDDDYDVK
NWEMLNELNAGQFEGMTYSEIAKRYPEEFHKRAEDKLNYIYPGVGGEGYLQVISRLRDMVREIERITDHVLIIGH
RSVCRVLMAYFMDLTRDDITDMDVPLGMLYSIEPKPYGIAFHAYKYDEAQGWFEELPHYKPQKAARGSV*
Coding >Hirsu2|7784
ATGCCTTCTGCAGTCGTCATACCCCGCCAAGATCTCGGTCGCAAGCAGGCCAAACAGTCGGCCCTGGCCAAGCTT
GTCATGCACAACACTCTCGCCTCATCCTCGCCGCCGCCCATCTCGCCCACGACGTCGGAGCCGGAGCCCCAGCTC
GCTGTTCTGCCGCCCCCCAGCATCCGCTATGGCCACTCGCCGTCCGCCGCCTCTCCGGCCATGGCCCACGCCGTC
CGCATCATGAAGGACCTGACCGACACGCCGCCGCTGTGCCAGAGCGTTAGCTCGACCGCGCCCAGCTCGCCGCGC
ATCCCGCCCCAGCGCCAGAACTCGGGAAACCAGACCCCCCGCGTGCGGCCCCATGCGACGACGCTCAACATCCCC
GGCATGACGAGGTCTCGCGTCTCGCCCGACGGCCGCATCCCCCAGCGCGACGTGGCCGCCAAGCTCGTCATCGTC
ATGGTCGGCCTGCCCGCCCGCGGCAAGTCGTACATCACCAAGAAGCTGCAGCGCTACCTGTCGTGGCAGCAGCAC
GAGTCCCGCATCTTCAACGTCGGCAACCGCCGCCGCCACGCCGCCGGCATCAAGGTCTCCGCCAAGCCCAAGCTC
GCCCCCGAGCCCGACTGCCTCGATCCGCCCGTCCAGGCCGCCACCATCCTCCTTAACGGCGGCCCCGCCCCCAAC
GCCGCGACGTCTCTGAGCCGCGACTGCACCGAGCCGACGGCCCTGCACCTCGACGCCGCCCCGGACGCCGACGCC
GACCAGTCGGCCAAGTTCTTCGACCCCCGGAACCAGAGGGCCGCCGCCATCCGCGACCAGGTCGCCATGGACACG
CTCGACGAGCTGCTCGACTACCTCCTCAACCTCGGCGGCGCCGTCGGCATCCTCGACGCTACCAATAGCACCATC
AGGCGCCGGCAGCAGATCGTCGACCGTATCCGCAGGCGCGAGCCCAAGCTCGGCATCCTCTTCATCGAGAGCATC
TGCAGGGATCAGAACCTGCTCGAGGCCAACATGCGCCTCAAGCTCTCGGGGCCCGACTACCGCGACAAGGATCCC
CACAAGTCGTTAGAGGACTTCAAAAACCGCGTCGCCGCCTACGCCAGCGCCTACGAGCCTCTCGGCGAGTACGAA
GAGGACAACGACATGCAGTACATCCAGATCGTAGATGTGGGACGGAAGCTCGTGCAACATCGACTCAAGGGCTTC
CTCAGCGGCGGCATCAGCACCTATCTCTCCAGCTTCAACCTCGCCCCGCGGCAGATCTGGATCACGCGGCACGGC
CAGAGCGTCGACAACGAGCTGGGCAAGCTGGGCGGCGACTCGCCGCTGACGGAGCGCGGACACTGCTACGGCCAG
GCCCTCTACAACTTCATCACGCAGAGGCGCAAGGAGTGGCTGATGGAGCAGAAGAGCAAGATGGCGCAGGCCTCG
TTCCCGCCGCTGCCGGGCGACAACACGCCGCCCTACCCCGACATGAACCGCGACCTGGACGAGAAGAACTTTTGC
GTCTGGACCTCGATGCTGCAGCGGAGCGTCGAGACGGCCGAGTATTTCGACGTCGACGACGACTACGACGTCAAG
AACTGGGAGATGCTCAACGAGCTCAACGCCGGCCAGTTCGAGGGCATGACGTACAGCGAGATCGCCAAGCGGTAC
CCCGAGGAGTTCCACAAGCGGGCCGAGGACAAGCTCAACTACATCTACCCGGGCGTCGGCGGCGAGGGCTACCTG
CAGGTCATCAGCCGCCTGCGCGACATGGTGCGCGAGATCGAGCGCATCACCGACCACGTCCTCATCATCGGCCAC
CGCTCCGTCTGCCGCGTTCTCATGGCCTACTTCATGGACCTGACGCGCGACGACATCACCGACATGGACGTGCCC
CTCGGCATGCTGTACTCGATCGAGCCCAAGCCGTACGGCATCGCCTTCCACGCCTACAAGTACGACGAGGCCCAG
GGCTGGTTCGAGGAGCTGCCCCACTACAAGCCGCAGAAGGCGGCCCGAGGCAGCGTCTAG
Transcript >Hirsu2|7784
ATGCCTTCTGCAGTCGTCATACCCCGCCAAGATCTCGGTCGCAAGCAGGCCAAACAGTCGGCCCTGGCCAAGCTT
GTCATGCACAACACTCTCGCCTCATCCTCGCCGCCGCCCATCTCGCCCACGACGTCGGAGCCGGAGCCCCAGCTC
GCTGTTCTGCCGCCCCCCAGCATCCGCTATGGCCACTCGCCGTCCGCCGCCTCTCCGGCCATGGCCCACGCCGTC
CGCATCATGAAGGACCTGACCGACACGCCGCCGCTGTGCCAGAGCGTTAGCTCGACCGCGCCCAGCTCGCCGCGC
ATCCCGCCCCAGCGCCAGAACTCGGGAAACCAGACCCCCCGCGTGCGGCCCCATGCGACGACGCTCAACATCCCC
GGCATGACGAGGTCTCGCGTCTCGCCCGACGGCCGCATCCCCCAGCGCGACGTGGCCGCCAAGCTCGTCATCGTC
ATGGTCGGCCTGCCCGCCCGCGGCAAGTCGTACATCACCAAGAAGCTGCAGCGCTACCTGTCGTGGCAGCAGCAC
GAGTCCCGCATCTTCAACGTCGGCAACCGCCGCCGCCACGCCGCCGGCATCAAGGTCTCCGCCAAGCCCAAGCTC
GCCCCCGAGCCCGACTGCCTCGATCCGCCCGTCCAGGCCGCCACCATCCTCCTTAACGGCGGCCCCGCCCCCAAC
GCCGCGACGTCTCTGAGCCGCGACTGCACCGAGCCGACGGCCCTGCACCTCGACGCCGCCCCGGACGCCGACGCC
GACCAGTCGGCCAAGTTCTTCGACCCCCGGAACCAGAGGGCCGCCGCCATCCGCGACCAGGTCGCCATGGACACG
CTCGACGAGCTGCTCGACTACCTCCTCAACCTCGGCGGCGCCGTCGGCATCCTCGACGCTACCAATAGCACCATC
AGGCGCCGGCAGCAGATCGTCGACCGTATCCGCAGGCGCGAGCCCAAGCTCGGCATCCTCTTCATCGAGAGCATC
TGCAGGGATCAGAACCTGCTCGAGGCCAACATGCGCCTCAAGCTCTCGGGGCCCGACTACCGCGACAAGGATCCC
CACAAGTCGTTAGAGGACTTCAAAAACCGCGTCGCCGCCTACGCCAGCGCCTACGAGCCTCTCGGCGAGTACGAA
GAGGACAACGACATGCAGTACATCCAGATCGTAGATGTGGGACGGAAGCTCGTGCAACATCGACTCAAGGGCTTC
CTCAGCGGCGGCATCAGCACCTATCTCTCCAGCTTCAACCTCGCCCCGCGGCAGATCTGGATCACGCGGCACGGC
CAGAGCGTCGACAACGAGCTGGGCAAGCTGGGCGGCGACTCGCCGCTGACGGAGCGCGGACACTGCTACGGCCAG
GCCCTCTACAACTTCATCACGCAGAGGCGCAAGGAGTGGCTGATGGAGCAGAAGAGCAAGATGGCGCAGGCCTCG
TTCCCGCCGCTGCCGGGCGACAACACGCCGCCCTACCCCGACATGAACCGCGACCTGGACGAGAAGAACTTTTGC
GTCTGGACCTCGATGCTGCAGCGGAGCGTCGAGACGGCCGAGTATTTCGACGTCGACGACGACTACGACGTCAAG
AACTGGGAGATGCTCAACGAGCTCAACGCCGGCCAGTTCGAGGGCATGACGTACAGCGAGATCGCCAAGCGGTAC
CCCGAGGAGTTCCACAAGCGGGCCGAGGACAAGCTCAACTACATCTACCCGGGCGTCGGCGGCGAGGGCTACCTG
CAGGTCATCAGCCGCCTGCGCGACATGGTGCGCGAGATCGAGCGCATCACCGACCACGTCCTCATCATCGGCCAC
CGCTCCGTCTGCCGCGTTCTCATGGCCTACTTCATGGACCTGACGCGCGACGACATCACCGACATGGACGTGCCC
CTCGGCATGCTGTACTCGATCGAGCCCAAGCCGTACGGCATCGCCTTCCACGCCTACAAGTACGACGAGGCCCAG
GGCTGGTTCGAGGAGCTGCCCCACTACAAGCCGCAGAAGGCGGCCCGAGGCAGCGTCTAG
Gene >Hirsu2|7784
ATGCCTTCTGCAGTCGTCATACCCCGCCAAGGTTTGTCCCAACTCTGTCTTTATCTCTCTATCTCTTCCCTCTTT
ATTTTTTTTTTAATTACTTTTGTCGCCCATTAGCCTCTCGGCTTACAGCATCACCCGTCTACGTCTTCTTCTTCT
TCCTCCTCCTCCTCCTCCTCCTCCTCCTCATCCTCCCATCGTTCTCTTCTTCACTCGCCCTTCCAATCCGTTTGC
TCTTATTTCTTCACTGCCGCTTCTACTACTATTCTTCTGAACAACTACCGCTTTCACCACCACCACCTCCTCCTC
CTCCTCCTCCTTCTCCCCCTCCTCCTCTGCGCCGGCAGGACTCGCATCGCAACCCGCCTCGCTCACCACCCTCGC
CTCCAGATCTCGGTCGCAAGCAGGCCAAACAGTCGGCCCTGGCCAAGCTTGTCATGCACAACACTCTCGCCTCAT
CCTCGCCGCCGCCCATCTCGCCCACGACGTCGGAGCCGGAGCCCCAGCTCGCTGTTCTGCCGCCCCCCAGCATCC
GCTATGGCCACTCGCCGTCCGCCGCCTCTCCGGCCATGGCCCACGCCGTCCGCATCATGAAGGACCTGACCGACA
CGCCGCCGCTGTGCCAGAGCGTTAGCTCGACCGCGCCCAGCTCGCCGCGCATGTGAGTCCGGGTCCCCGTCCTCC
CCGTCCCGCCCGCTCTCGAGGCTCCGGCTGATCCTCGTCCTCAGCCCGCCCCAGCGCCAGAACTCGGGAAACCAG
ACCCCCCGCGTGCGGCCCCATGCGACGACGCTCAACATCCCCGGCATGACGAGGTCTCGCGTCTCGCCCGACGGC
CGCATCCCCCAGCGCGACGTGGCCGCCAAGCTCGTCATCGTCATGGTCGGCCTGCCCGCCCGCGGCAAGTCGTAC
ATCACCAAGAAGCTGCAGCGCTACCTGTCGTGGCAGCAGCACGAGTCCCGCATCTTCAACGTCGGCAACCGCCGC
CGCCACGCCGCCGGCATCAAGGTCTCCGCCAAGCCCAAGCTCGCCCCCGAGCCCGACTGCCTCGATCCGCCCGTC
CAGGCCGCCACCATCCTCCTTAACGGCGGCCCCGCCCCCAACGCCGCGACGTCTCTGAGCCGCGACTGCACCGAG
CCGACGGCCCTGCACCTCGACGCCGCCCCGGACGCCGACGCCGACCAGTCGGCCAAGTTCTTCGACCCCCGGAAC
CAGAGGGCCGCCGCCATCCGCGACCAGGTCGCCATGGACACGCTCGACGAGCTGCTCGACTACCTCCTCAACCTC
GGCGGCGCCGTCGGCATCCTCGACGCTACCAATAGCACCATCAGGCGCCGGCAGCAGATCGTCGACCGTATCCGC
AGGCGCGAGCCCAAGCTCGGCATCCTCTTCATCGAGAGCATCTGCAGGGATCAGAACCTGCTCGAGGCCAACATG
CGCCTCAAGCTCTCGGGGCCCGACTACCGCGACAAGGATCCCCACAAGTCGTTAGAGGACTTCAAAAACCGCGTC
GCCGCCTACGCCAGCGCCTACGAGCCTCTCGGCGAGTACGAAGAGGACAACGACATGCAGTACATCCAGGTGCGC
TCTCCTTCGACCTTTCCAGAGCCGGCGAAGCGGCCGAGTTTGCGTGGGCCACAAAAACTAACAATATCGTTCAGA
TCGTAGATGTGGGACGGAAGCTCGTGCAACATCGACTCAAGGGCTTCCTCAGCGGCGGCATCAGCACCTATCTCT
CCAGCTTCAACCTCGCCCCGCGGCAGATCTGGATCACGCGGCACGGCCAGAGCGTCGACAACGAGCTGGGCAAGC
TGGGCGGCGACTCGCCGCTGACGGAGCGCGGACACTGCTACGGCCAGGCCCTCTACAACTTCATCACGCAGAGGC
GCAAGGAGTGGCTGATGGAGCAGAAGAGCAAGATGGCGCAGGCCTCGTTCCCGCCGCTGCCGGGCGACAACACGC
CGCCCTACCCCGACATGAACCGCGACCTGGACGAGAAGAACTTTTGCGTCTGGACCTCGATGCTGCAGCGGAGCG
TCGAGACGGCCGAGTATTTCGACGTCGACGACGACTACGACGTCAAGAACTGGGAGATGCTCAACGAGCTCAACG
CCGGCCAGTTCGAGGGCATGACGTACAGCGAGATCGCCAAGCGGTACCCCGAGGAGTTCCACAAGCGGGCCGAGG
ACAAGCTCAACTACATCTACCCGGGCGTCGGCGGCGAGGGCTACCTGCAGGTCATCAGCCGCCTGCGCGACATGG
TGCGCGAGATCGAGCGCATCACCGACCACGTCCTCATCATCGGCCACCGCTCCGTCTGCCGCGTTCTCATGGCCT
ACTTCATGGACCTGACGCGCGACGACATCACCGACATGGACGTGCCCCTCGGCATGCTGTACTCGATCGAGCCCA
AGCCGTACGGCATCGCCTTCCACGCCTACAAGTACGACGAGGCCCAGGGCTGGTTCGAGGAGCTGCCCCACTACA
AGCCGCAGAAGGCGGCCCGAGGCAGCGTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail