Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7781
Gene name
LocationContig_472:3565..4362
Strand+
Gene length (bp)797
Transcript length (bp)732
Coding sequence length (bp)732
Protein length (aa) 244

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00153 Mito_carr Mitochondrial carrier protein 1.1E-06 97 142
PF00153 Mito_carr Mitochondrial carrier protein 7.8E-16 150 234
PF04756 OST3_OST6 OST3 / OST6 family, transporter family 3.9E-16 43 95

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06143|DIC1_YEAST Mitochondrial dicarboxylate transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIC1 PE=1 SV=1 93 230 3.0E-31
sp|Q6FTN2|DIC1_CANGA Mitochondrial dicarboxylate transporter OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DIC1 PE=3 SV=1 93 233 7.0E-27
sp|Q02978|M2OM_HUMAN Mitochondrial 2-oxoglutarate/malate carrier protein OS=Homo sapiens GN=SLC25A11 PE=1 SV=3 97 235 2.0E-25
sp|Q9CR62|M2OM_MOUSE Mitochondrial 2-oxoglutarate/malate carrier protein OS=Mus musculus GN=Slc25a11 PE=1 SV=3 97 235 3.0E-25
sp|P22292|M2OM_BOVIN Mitochondrial 2-oxoglutarate/malate carrier protein OS=Bos taurus GN=SLC25A11 PE=1 SV=3 97 235 3.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06143|DIC1_YEAST Mitochondrial dicarboxylate transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIC1 PE=1 SV=1 93 230 3.0E-31
sp|Q6FTN2|DIC1_CANGA Mitochondrial dicarboxylate transporter OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DIC1 PE=3 SV=1 93 233 7.0E-27
sp|Q02978|M2OM_HUMAN Mitochondrial 2-oxoglutarate/malate carrier protein OS=Homo sapiens GN=SLC25A11 PE=1 SV=3 97 235 2.0E-25
sp|Q9CR62|M2OM_MOUSE Mitochondrial 2-oxoglutarate/malate carrier protein OS=Mus musculus GN=Slc25a11 PE=1 SV=3 97 235 3.0E-25
sp|P22292|M2OM_BOVIN Mitochondrial 2-oxoglutarate/malate carrier protein OS=Bos taurus GN=SLC25A11 PE=1 SV=3 97 235 3.0E-25
sp|Q9SB52|PUMP4_ARATH Mitochondrial uncoupling protein 4 OS=Arabidopsis thaliana GN=PUMP4 PE=2 SV=1 94 233 8.0E-25
sp|Q9UBX3|DIC_HUMAN Mitochondrial dicarboxylate carrier OS=Homo sapiens GN=SLC25A10 PE=1 SV=2 97 232 1.0E-24
sp|Q54PY7|M2OM_DICDI Probable mitochondrial 2-oxoglutarate/malate carrier protein OS=Dictyostelium discoideum GN=ucpC PE=3 SV=1 97 234 2.0E-24
sp|P97700|M2OM_RAT Mitochondrial 2-oxoglutarate/malate carrier protein OS=Rattus norvegicus GN=Slc25a11 PE=1 SV=3 97 235 3.0E-24
sp|Q9SJY5|PUMP5_ARATH Mitochondrial uncoupling protein 5 OS=Arabidopsis thaliana GN=PUMP5 PE=2 SV=1 97 233 5.0E-24
sp|O97649|UCP3_PIG Mitochondrial uncoupling protein 3 OS=Sus scrofa GN=UCP3 PE=2 SV=1 94 241 6.0E-23
sp|O77792|UCP3_BOVIN Mitochondrial uncoupling protein 3 OS=Bos taurus GN=UCP3 PE=2 SV=1 94 241 9.0E-23
sp|Q9QZD8|DIC_MOUSE Mitochondrial dicarboxylate carrier OS=Mus musculus GN=Slc25a10 PE=1 SV=2 97 232 3.0E-22
sp|Q9N2I9|UCP3_CANLF Mitochondrial uncoupling protein 3 OS=Canis lupus familiaris GN=UCP3 PE=2 SV=1 94 241 4.0E-22
sp|B0G143|UCPB_DICDI Mitochondrial substrate carrier family protein ucpB OS=Dictyostelium discoideum GN=ucpB PE=3 SV=1 101 231 2.0E-21
sp|P55916|UCP3_HUMAN Mitochondrial uncoupling protein 3 OS=Homo sapiens GN=UCP3 PE=1 SV=1 94 241 2.0E-21
sp|Q9FY68|PUMP6_ARATH Mitochondrial uncoupling protein 6 OS=Arabidopsis thaliana GN=PUMP6 PE=2 SV=1 93 236 3.0E-20
sp|O81845|PUMP1_ARATH Mitochondrial uncoupling protein 1 OS=Arabidopsis thaliana GN=PUMP1 PE=1 SV=1 94 235 1.0E-19
sp|Q9Z2B2|UCP5_MOUSE Brain mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a14 PE=1 SV=2 104 230 1.0E-19
sp|Q9ZWG1|PUMP2_ARATH Mitochondrial uncoupling protein 2 OS=Arabidopsis thaliana GN=PUMP2 PE=2 SV=1 94 232 2.0E-19
sp|P56501|UCP3_MOUSE Mitochondrial uncoupling protein 3 OS=Mus musculus GN=Ucp3 PE=1 SV=1 93 241 3.0E-19
sp|P25874|UCP1_HUMAN Mitochondrial brown fat uncoupling protein 1 OS=Homo sapiens GN=UCP1 PE=2 SV=3 106 234 3.0E-19
sp|Q9W720|UCP2_DANRE Mitochondrial uncoupling protein 2 OS=Danio rerio GN=ucp2 PE=2 SV=1 97 231 3.0E-19
sp|Q6GQ22|KMCP1_XENLA Kidney mitochondrial carrier protein 1 OS=Xenopus laevis GN=slc25a30 PE=2 SV=1 88 230 3.0E-19
sp|O95258|UCP5_HUMAN Brain mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A14 PE=2 SV=1 104 230 4.0E-19
sp|Q5XGI1|KMCP1_XENTR Kidney mitochondrial carrier protein 1 OS=Xenopus tropicalis GN=slc25a30 PE=2 SV=1 88 230 5.0E-19
sp|P56499|UCP3_RAT Mitochondrial uncoupling protein 3 OS=Rattus norvegicus GN=Ucp3 PE=2 SV=1 93 241 7.0E-19
sp|Q9W725|UCP2_CYPCA Mitochondrial uncoupling protein 2 OS=Cyprinus carpio GN=ucp2 PE=2 SV=1 94 231 1.0E-18
sp|Q8HXE3|KMCP1_MACFA Kidney mitochondrial carrier protein 1 OS=Macaca fascicularis GN=SLC25A30 PE=2 SV=1 94 239 3.0E-18
sp|Q9N2J1|UCP2_CANLF Mitochondrial uncoupling protein 2 OS=Canis lupus familiaris GN=UCP2 PE=2 SV=1 93 231 5.0E-18
sp|Q9CR58|KMCP1_MOUSE Kidney mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a30 PE=1 SV=1 94 239 6.0E-18
sp|O95847|UCP4_HUMAN Mitochondrial uncoupling protein 4 OS=Homo sapiens GN=SLC25A27 PE=2 SV=1 93 230 6.0E-18
sp|Q5SVS4|KMCP1_HUMAN Kidney mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A30 PE=1 SV=1 94 239 7.0E-18
sp|P70406|UCP2_MOUSE Mitochondrial uncoupling protein 2 OS=Mus musculus GN=Ucp2 PE=1 SV=1 102 231 7.0E-18
sp|P56500|UCP2_RAT Mitochondrial uncoupling protein 2 OS=Rattus norvegicus GN=Ucp2 PE=2 SV=1 102 231 1.0E-17
sp|Q5PQM9|KMCP1_RAT Kidney mitochondrial carrier protein 1 OS=Rattus norvegicus GN=Slc25a30 PE=2 SV=1 102 239 1.0E-17
sp|P55851|UCP2_HUMAN Mitochondrial uncoupling protein 2 OS=Homo sapiens GN=UCP2 PE=1 SV=1 102 231 1.0E-17
sp|Q5R5A8|UCP2_PONAB Mitochondrial uncoupling protein 2 OS=Pongo abelii GN=UCP2 PE=2 SV=1 102 231 1.0E-17
sp|Q18P97|UCP1_SUNMU Mitochondrial brown fat uncoupling protein 1 OS=Suncus murinus GN=UCP1 PE=2 SV=1 94 234 2.0E-17
sp|O97562|UCP2_PIG Mitochondrial uncoupling protein 2 OS=Sus scrofa GN=UCP2 PE=2 SV=1 80 231 2.0E-17
sp|Q9GMZ1|UCP1_CANLF Mitochondrial brown fat uncoupling protein 1 OS=Canis lupus familiaris GN=UCP1 PE=2 SV=1 106 234 4.0E-17
sp|P14271|UCP1_RABIT Mitochondrial brown fat uncoupling protein 1 OS=Oryctolagus cuniculus GN=UCP1 PE=2 SV=1 106 237 5.0E-17
sp|Q3SZI5|UCP2_BOVIN Mitochondrial uncoupling protein 2 OS=Bos taurus GN=UCP2 PE=2 SV=1 102 231 7.0E-17
sp|P04633|UCP1_RAT Mitochondrial brown fat uncoupling protein 1 OS=Rattus norvegicus GN=Ucp1 PE=1 SV=2 101 240 8.0E-17
sp|P10861|UCP1_BOVIN Mitochondrial brown fat uncoupling protein 1 (Fragment) OS=Bos taurus GN=UCP1 PE=2 SV=2 106 240 3.0E-16
sp|P12242|UCP1_MOUSE Mitochondrial brown fat uncoupling protein 1 OS=Mus musculus GN=Ucp1 PE=1 SV=2 101 234 7.0E-16
sp|A0PC02|UCP1_OCHDA Mitochondrial brown fat uncoupling protein 1 OS=Ochotona dauurica GN=UCP1 PE=2 SV=1 101 234 8.0E-16
sp|Q9XI74|PUMP3_ARATH Mitochondrial uncoupling protein 3 OS=Arabidopsis thaliana GN=PUMP3 PE=2 SV=1 94 240 1.0E-15
sp|Q9ER18|UCP1_PHOSU Mitochondrial brown fat uncoupling protein 1 OS=Phodopus sungorus GN=UCP1 PE=2 SV=1 101 240 9.0E-15
sp|P04575|UCP1_MESAU Mitochondrial brown fat uncoupling protein 1 OS=Mesocricetus auratus GN=UCP1 PE=1 SV=3 113 240 9.0E-15
sp|Q55BF4|UCPA_DICDI Mitochondrial substrate carrier family protein ucpA OS=Dictyostelium discoideum GN=ucpA PE=3 SV=1 101 232 2.0E-14
sp|Q8K404|UCP1_DICGR Mitochondrial brown fat uncoupling protein 1 OS=Dicrostonyx groenlandicus GN=UCP1 PE=2 SV=1 113 234 1.0E-13
sp|P32332|OAC1_YEAST Mitochondrial oxaloacetate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OAC1 PE=1 SV=1 97 230 3.0E-13
sp|P29518|BT1_MAIZE Adenine nucleotide transporter BT1, chloroplastic/amyloplastic/mitochondrial OS=Zea mays GN=BT1 PE=1 SV=1 102 237 6.0E-11
sp|O04619|ADNT1_ARATH Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 93 227 1.0E-10
sp|Q96CQ1|S2536_HUMAN Solute carrier family 25 member 36 OS=Homo sapiens GN=SLC25A36 PE=1 SV=1 87 226 6.0E-10
sp|Q6PH61|S2534_DANRE Solute carrier family 25 member 34 OS=Danio rerio GN=slc25a34 PE=2 SV=1 93 230 9.0E-10
sp|Q3KQZ1|S2535_HUMAN Solute carrier family 25 member 35 OS=Homo sapiens GN=SLC25A35 PE=2 SV=1 93 232 2.0E-09
sp|Q5SWT3|S2535_MOUSE Solute carrier family 25 member 35 OS=Mus musculus GN=Slc25a35 PE=1 SV=2 93 233 2.0E-09
sp|Q6DG32|S2536_DANRE Solute carrier family 25 member 36-A OS=Danio rerio GN=slc25a36a PE=2 SV=1 87 240 3.0E-09
sp|Q5ZKP7|S2536_CHICK Solute carrier family 25 member 36 OS=Gallus gallus GN=SLC25A36 PE=2 SV=1 94 230 5.0E-09
sp|Q66L49|SCMC1_DANRE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Danio rerio GN=slc25a24 PE=2 SV=1 96 217 6.0E-09
sp|Q9UTN1|OAC1_SCHPO Mitochondrial oxaloacetate transport protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oac1 PE=3 SV=1 78 236 6.0E-09
sp|Q6PIV7|S2534_HUMAN Solute carrier family 25 member 34 OS=Homo sapiens GN=SLC25A34 PE=2 SV=1 99 230 6.0E-09
sp|Q922G0|S2536_MOUSE Solute carrier family 25 member 36 OS=Mus musculus GN=Slc25a36 PE=2 SV=1 87 236 7.0E-09
sp|Q6DFK2|S2540_XENLA Solute carrier family 25 member 40 OS=Xenopus laevis GN=slc25a40 PE=2 SV=1 106 237 9.0E-09
sp|A2ADF7|S2534_MOUSE Solute carrier family 25 member 34 OS=Mus musculus GN=Slc25a34 PE=1 SV=1 93 230 2.0E-08
sp|Q9SUV1|BRT1_ARATH Adenine nucleotide transporter BT1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=BT1 PE=1 SV=1 102 242 2.0E-08
sp|Q54FE6|MCFS_DICDI Mitochondrial substrate carrier family protein S OS=Dictyostelium discoideum GN=mcfS PE=3 SV=1 93 230 2.0E-08
sp|P0C582|M2OM_NEUCR Putative mitochondrial 2-oxoglutarate/malate carrier protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mic-33 PE=3 SV=1 97 223 2.0E-08
sp|P53257|TPC1_YEAST Mitochondrial thiamine pyrophosphate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPC1 PE=1 SV=1 102 210 2.0E-08
sp|Q6NUK1|SCMC1_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens GN=SLC25A24 PE=1 SV=2 98 229 3.0E-08
sp|Q95J75|MFTC_MACFA Mitochondrial folate transporter/carrier OS=Macaca fascicularis GN=SLC25A32 PE=2 SV=1 48 226 3.0E-08
sp|O18757|SCMC1_RABIT Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Oryctolagus cuniculus GN=SLC25A24 PE=1 SV=1 98 228 3.0E-08
sp|A5PJZ1|SCMC1_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Bos taurus GN=SLC25A24 PE=2 SV=1 98 228 3.0E-08
sp|Q6P316|S2540_XENTR Solute carrier family 25 member 40 OS=Xenopus tropicalis GN=slc25a40 PE=2 SV=1 103 237 3.0E-08
sp|P38152|TXTP_YEAST Tricarboxylate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTP1 PE=2 SV=3 82 214 4.0E-08
sp|Q8BMG8|MFTC_MOUSE Mitochondrial folate transporter/carrier OS=Mus musculus GN=Slc25a32 PE=1 SV=1 93 226 4.0E-08
sp|Q5XH95|SCMC2_XENTR Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus tropicalis GN=slc25a25 PE=2 SV=1 98 232 4.0E-08
sp|Q9H2D1|MFTC_HUMAN Mitochondrial folate transporter/carrier OS=Homo sapiens GN=SLC25A32 PE=1 SV=2 48 226 5.0E-08
sp|Q6NYZ6|SCM2A_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-A OS=Danio rerio GN=slc25a25a PE=2 SV=1 97 241 5.0E-08
sp|Q58DS3|S2535_BOVIN Solute carrier family 25 member 35 OS=Bos taurus GN=SLC25A35 PE=2 SV=1 154 232 5.0E-08
sp|Q3SZK0|S2534_BOVIN Solute carrier family 25 member 34 OS=Bos taurus GN=SLC25A34 PE=2 SV=1 99 230 6.0E-08
sp|A6ZV78|TPC1_YEAS7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=TPC1 PE=3 SV=1 102 210 6.0E-08
sp|Q8BMD8|SCMC1_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Mus musculus GN=Slc25a24 PE=1 SV=1 98 227 7.0E-08
sp|Q12289|CRC1_YEAST Mitochondrial carnitine carrier OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRC1 PE=1 SV=1 92 234 8.0E-08
sp|A3KPP4|S2535_DANRE Solute carrier family 25 member 35 OS=Danio rerio GN=slc25a35 PE=2 SV=1 93 224 9.0E-08
sp|Q5XIF9|S2534_RAT Solute carrier family 25 member 34 OS=Rattus norvegicus GN=Slc25a34 PE=2 SV=2 93 230 9.0E-08
sp|O13660|YBC9_SCHPO Uncharacterized mitochondrial carrier C27B12.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi069 PE=3 SV=1 61 230 1.0E-07
sp|Q7ZYD5|SCMC2_XENLA Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus laevis GN=slc25a25 PE=2 SV=1 98 232 1.0E-07
sp|Q5XHA0|SCMC1_XENTR Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Xenopus tropicalis GN=slc25a24 PE=2 SV=1 92 217 1.0E-07
sp|Q8RWA5|NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana GN=NDT2 PE=1 SV=1 88 235 1.0E-07
sp|Q54B67|MCFZ_DICDI Mitochondrial substrate carrier family protein Z OS=Dictyostelium discoideum GN=mcfZ PE=2 SV=1 153 227 1.0E-07
sp|Q7ZY36|SCM1A_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-A OS=Xenopus laevis GN=slc25a24-a PE=2 SV=2 93 217 2.0E-07
sp|Q6KCM7|SCMC2_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Homo sapiens GN=SLC25A25 PE=1 SV=1 94 232 2.0E-07
sp|Q7T0U6|SCM1B_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-B OS=Xenopus laevis GN=slc25a24-b PE=2 SV=1 92 217 2.0E-07
sp|Q9C5M0|DTC_ARATH Mitochondrial dicarboxylate/tricarboxylate transporter DTC OS=Arabidopsis thaliana GN=DTC PE=1 SV=1 99 235 2.0E-07
sp|Q0V7M4|SCMC2_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Bos taurus GN=SLC25A25 PE=2 SV=1 98 232 3.0E-07
sp|Q6GQS1|SCMC3_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Mus musculus GN=Slc25a23 PE=1 SV=1 98 217 4.0E-07
sp|Q5SVS4|KMCP1_HUMAN Kidney mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A30 PE=1 SV=1 93 206 5.0E-07
sp|Q8K3P6|SCMC2_RAT Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Rattus norvegicus GN=Slc25a25 PE=1 SV=1 98 217 5.0E-07
sp|A2ASZ8|SCMC2_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Mus musculus GN=Slc25a25 PE=1 SV=1 98 217 7.0E-07
sp|Q8HXE3|KMCP1_MACFA Kidney mitochondrial carrier protein 1 OS=Macaca fascicularis GN=SLC25A30 PE=2 SV=1 93 206 8.0E-07
sp|A2CEQ0|SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio GN=slc25a25b PE=3 SV=2 94 217 8.0E-07
sp|Q8CFJ7|S2545_MOUSE Solute carrier family 25 member 45 OS=Mus musculus GN=Slc25a45 PE=1 SV=1 93 233 9.0E-07
sp|O04619|ADNT1_ARATH Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 94 226 1.0E-06
sp|O65023|EAAC_ARATH Probable envelope ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=EAAC PE=2 SV=2 87 234 1.0E-06
sp|Q628Z2|CMC3_CAEBR Probable calcium-binding mitochondrial carrier CBG00135 OS=Caenorhabditis briggsae GN=CBG00135 PE=3 SV=1 100 234 1.0E-06
sp|Q9P3T7|ODC_SCHPO Probable mitochondrial 2-oxodicarboxylate carrier OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.09 PE=3 SV=1 93 216 1.0E-06
sp|Q9M024|TAAC_ARATH Thylakoid ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=TAAC PE=1 SV=1 92 231 1.0E-06
sp|Q54EV4|MCFA_DICDI Mitochondrial substrate carrier family protein A OS=Dictyostelium discoideum GN=mcfA PE=3 SV=1 102 230 1.0E-06
sp|P55916|UCP3_HUMAN Mitochondrial uncoupling protein 3 OS=Homo sapiens GN=UCP3 PE=1 SV=1 90 213 2.0E-06
sp|Q9P6N6|S2538_SCHPO Solute carrier family 25 member 38 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC823.10c PE=3 SV=1 85 235 2.0E-06
sp|Q9BV35|SCMC3_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Homo sapiens GN=SLC25A23 PE=1 SV=2 98 217 2.0E-06
sp|Q09461|YQ51_CAEEL Uncharacterized mitochondrial carrier C16C10.1 OS=Caenorhabditis elegans GN=C16C10.1 PE=3 SV=2 106 234 2.0E-06
sp|Q9FMU6|MPCP3_ARATH Mitochondrial phosphate carrier protein 3, mitochondrial OS=Arabidopsis thaliana GN=MPT3 PE=2 SV=1 93 226 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7781
MRFFTMLAGALALRAAAEEAQKPMGERFDRFHGHGKLLAAPNQLDDTSYRALTRAPRDYSVAVLLTALDARFGCQ
LCREFQPEWDLLGRVWAKGDADGLARMVRHEGALSCFRGWLPNSSRAAVMTAGQLATYDAFKRALIRYTPLGDTL
TTHLSASFLAGLAAATATSPIDVIKTRVMSSTQNQGVLRLVADIYRTDGIGWMFKGWVPSFLRLGPHTICTFVFL
EMHRKAYRKLKGLDDSGL*
Coding >Hirsu2|7781
ATGCGGTTTTTCACGATGCTCGCCGGGGCGCTCGCGCTGCGCGCCGCGGCCGAGGAGGCGCAGAAGCCGATGGGC
GAGCGCTTCGACCGCTTCCACGGCCACGGCAAGCTGCTGGCCGCGCCCAACCAGCTCGACGACACGTCGTACCGG
GCCCTGACGCGCGCGCCGCGCGACTACAGCGTCGCCGTCCTGCTGACGGCCCTCGACGCCCGCTTCGGCTGCCAG
CTGTGCCGCGAGTTCCAGCCCGAATGGGACCTGCTCGGCCGTGTCTGGGCCAAGGGCGACGCCGACGGCCTGGCC
CGCATGGTCCGCCACGAGGGCGCCCTCAGCTGCTTCCGCGGCTGGCTGCCCAACAGCAGCCGCGCCGCCGTCATG
ACGGCCGGCCAGCTGGCCACCTACGACGCCTTCAAGCGCGCCCTCATCCGCTACACGCCCCTCGGCGACACCCTC
ACCACCCATCTGTCCGCCTCCTTCCTCGCCGGCCTCGCCGCCGCCACCGCCACCAGCCCCATCGACGTCATCAAG
ACGCGCGTCATGTCCTCGACCCAGAACCAGGGCGTCCTGCGCCTCGTCGCCGACATCTACCGCACCGACGGCATC
GGCTGGATGTTCAAGGGCTGGGTCCCCAGCTTCCTCCGACTCGGCCCCCATACCATCTGTACATTTGTTTTCCTC
GAAATGCATCGCAAGGCATATAGAAAGCTCAAGGGCCTGGACGACTCCGGTCTATAG
Transcript >Hirsu2|7781
ATGCGGTTTTTCACGATGCTCGCCGGGGCGCTCGCGCTGCGCGCCGCGGCCGAGGAGGCGCAGAAGCCGATGGGC
GAGCGCTTCGACCGCTTCCACGGCCACGGCAAGCTGCTGGCCGCGCCCAACCAGCTCGACGACACGTCGTACCGG
GCCCTGACGCGCGCGCCGCGCGACTACAGCGTCGCCGTCCTGCTGACGGCCCTCGACGCCCGCTTCGGCTGCCAG
CTGTGCCGCGAGTTCCAGCCCGAATGGGACCTGCTCGGCCGTGTCTGGGCCAAGGGCGACGCCGACGGCCTGGCC
CGCATGGTCCGCCACGAGGGCGCCCTCAGCTGCTTCCGCGGCTGGCTGCCCAACAGCAGCCGCGCCGCCGTCATG
ACGGCCGGCCAGCTGGCCACCTACGACGCCTTCAAGCGCGCCCTCATCCGCTACACGCCCCTCGGCGACACCCTC
ACCACCCATCTGTCCGCCTCCTTCCTCGCCGGCCTCGCCGCCGCCACCGCCACCAGCCCCATCGACGTCATCAAG
ACGCGCGTCATGTCCTCGACCCAGAACCAGGGCGTCCTGCGCCTCGTCGCCGACATCTACCGCACCGACGGCATC
GGCTGGATGTTCAAGGGCTGGGTCCCCAGCTTCCTCCGACTCGGCCCCCATACCATCTGTACATTTGTTTTCCTC
GAAATGCATCGCAAGGCATATAGAAAGCTCAAGGGCCTGGACGACTCCGGTCTATAG
Gene >Hirsu2|7781
ATGCGGTTTTTCACGATGCTCGCCGGGGCGCTCGCGCTGCGCGCCGCGGCCGAGGAGGCGCAGAAGCCGATGGGC
GAGCGCTTCGACCGCTTCCACGGCCACGGCAAGCTGCTGGCCGCGCCCAACCAGCTCGACGACACGTCGTACCGG
GCCCTGACGCGCGCGCCGCGCGACTACAGCGTCGCCGTCCTGCTGACGGCCCTCGACGCCCGCTTCGGCTGCCAG
CTGTGCCGCGAGTTCCAGCCCGAATGGGACCTGCTCGGCCGTGTCTGGGCCAAGGGCGACGCCGACGGCCTGGCC
CGCATGGTCCGCCACGAGGGCGCCCTCAGCTGCTTCCGCGGCTGGCTGCCCAACAGCAGCCGCGCCGCCGTCATG
ACGGCCGGCCAGCTGGCCACCTACGACGCCTTCAAGCGCGCCCTCATCCGCTACACGCCCCTCGGCGACACCCTC
ACCACCCATCTGTCCGCCTCCTTCCTCGCCGGCCTCGCCGCCGCCACCGCCACCAGCCCCATCGACGTCATCAAG
ACGCGCGTCATGTCCTCGACCCAGAACCAGGGCGTCCTGCGCCTCGTCGCCGACATCTACCGCACCGACGGCATC
GGCTGGATGTTCAAGGGCTGGGTCCCCAGCTTCCTCCGACTCGGCCCGTGAGTCTTCTTCCCCGCCCCCCCCCCC
GTCTGCTGACGACAAGCTCACCAACTCGTCCGCCCAGCCATACCATCTGTACATTTGTTTTCCTCGAAATGCATC
GCAAGGCATATAGAAAGCTCAAGGGCCTGGACGACTCCGGTCTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail