Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7770
Gene name
LocationContig_470:18500..18749
Strand-
Gene length (bp)249
Transcript length (bp)249
Coding sequence length (bp)249
Protein length (aa) 83

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P42881|GPT_SCHPO UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpt2 PE=3 SV=1 1 75 1.0E-12
sp|P07286|GPT_YEAST UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG7 PE=3 SV=1 1 75 3.0E-12

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Peroxisome Signal peptide 0.3135 0.4125 0.2971 0.1059 0.3159 0.0304 0.5136 0.363 0.114 0.5161

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3489
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6659
Ophiocordyceps australis map64 (Brazil) OphauB2|5945
Ophiocordyceps camponoti-floridani Ophcf2|03968
Ophiocordyceps camponoti-rufipedis Ophun1|7017
Ophiocordyceps kimflemingae Ophio5|2922
Ophiocordyceps subramaniannii Hirsu2|666
Ophiocordyceps subramaniannii Hirsu2|7770 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7770
LRLLARLRLARLAHDDDGRLRASSNLTLLNLWLLWRGPLREDRLAWEVTLLQLAAGLFGLFVRHRLALLVFKEDN
WGTAQLH*
Coding >Hirsu2|7770
CTGCGCCTGCTGGCCCGCCTGCGCCTCGCCCGCCTCGCCCACGACGACGACGGCCGCCTGCGCGCGTCCTCCAAC
CTCACCCTCCTCAACCTCTGGCTCCTCTGGCGCGGGCCCCTGCGCGAGGACCGCCTCGCCTGGGAGGTGACGCTG
CTGCAGCTCGCCGCCGGCCTCTTCGGCCTCTTCGTCCGCCACCGCCTCGCCCTGCTCGTCTTTAAGGAGGACAAC
TGGGGCACCGCGCAGCTGCACTAG
Transcript >Hirsu2|7770
CTGCGCCTGCTGGCCCGCCTGCGCCTCGCCCGCCTCGCCCACGACGACGACGGCCGCCTGCGCGCGTCCTCCAAC
CTCACCCTCCTCAACCTCTGGCTCCTCTGGCGCGGGCCCCTGCGCGAGGACCGCCTCGCCTGGGAGGTGACGCTG
CTGCAGCTCGCCGCCGGCCTCTTCGGCCTCTTCGTCCGCCACCGCCTCGCCCTGCTCGTCTTTAAGGAGGACAAC
TGGGGCACCGCGCAGCTGCACTAG
Gene >Hirsu2|7770
CTGCGCCTGCTGGCCCGCCTGCGCCTCGCCCGCCTCGCCCACGACGACGACGGCCGCCTGCGCGCGTCCTCCAAC
CTCACCCTCCTCAACCTCTGGCTCCTCTGGCGCGGGCCCCTGCGCGAGGACCGCCTCGCCTGGGAGGTGACGCTG
CTGCAGCTCGCCGCCGGCCTCTTCGGCCTCTTCGTCCGCCACCGCCTCGCCCTGCTCGTCTTTAAGGAGGACAAC
TGGGGCACCGCGCAGCTGCACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail