Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7769
Gene name
LocationContig_470:14722..17461
Strand+
Gene length (bp)2739
Transcript length (bp)2739
Coding sequence length (bp)2739
Protein length (aa) 913

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00628 PHD PHD-finger 8.6E-08 49 97
PF00856 SET SET domain 2.3E-05 318 403

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10362|SET3_SCHPO SET domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=set3 PE=1 SV=1 45 409 1.0E-21
sp|P36124|SET3_YEAST SET domain-containing protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SET3 PE=1 SV=1 46 474 1.0E-18
sp|P42948|SET4_YEAST SET domain-containing protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SET4 PE=3 SV=1 314 471 8.0E-14
sp|Q3UG20|KMT2E_MOUSE Histone-lysine N-methyltransferase 2E OS=Mus musculus GN=Kmt2e PE=1 SV=2 48 113 4.0E-09
sp|Q8IZD2|KMT2E_HUMAN Histone-lysine N-methyltransferase 2E OS=Homo sapiens GN=KMT2E PE=1 SV=1 48 113 6.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10362|SET3_SCHPO SET domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=set3 PE=1 SV=1 45 409 1.0E-21
sp|P36124|SET3_YEAST SET domain-containing protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SET3 PE=1 SV=1 46 474 1.0E-18
sp|P42948|SET4_YEAST SET domain-containing protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SET4 PE=3 SV=1 314 471 8.0E-14
sp|Q3UG20|KMT2E_MOUSE Histone-lysine N-methyltransferase 2E OS=Mus musculus GN=Kmt2e PE=1 SV=2 48 113 4.0E-09
sp|Q8IZD2|KMT2E_HUMAN Histone-lysine N-methyltransferase 2E OS=Homo sapiens GN=KMT2E PE=1 SV=1 48 113 6.0E-09
sp|Q8IZD2|KMT2E_HUMAN Histone-lysine N-methyltransferase 2E OS=Homo sapiens GN=KMT2E PE=1 SV=1 300 407 2.0E-08
sp|Q9NR48|ASH1L_HUMAN Histone-lysine N-methyltransferase ASH1L OS=Homo sapiens GN=ASH1L PE=1 SV=2 41 103 1.0E-07
sp|Q99MY8|ASH1L_MOUSE Histone-lysine N-methyltransferase ASH1L OS=Mus musculus GN=Ash1l PE=1 SV=3 41 103 2.0E-07
sp|Q9VW15|ASH1_DROME Histone-lysine N-methyltransferase ash1 OS=Drosophila melanogaster GN=ash1 PE=1 SV=3 22 107 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3676 0.8941 0.1211 0.0194 0.054 0.0119 0.0367 0.0046 0.0179 0.0024

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3900
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6658
Ophiocordyceps australis map64 (Brazil) OphauB2|5946
Ophiocordyceps camponoti-floridani Ophcf2|03969
Ophiocordyceps camponoti-rufipedis Ophun1|7016
Ophiocordyceps kimflemingae Ophio5|2923
Ophiocordyceps subramaniannii Hirsu2|7769 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7769
MTEKSAPSPTQTAVPSQGPPAAPVAPVAKHEPPAKAPETVEEEPYTIKCICNFSDDDGNTIYCETCDTWQHIDCF
YPDNRDEAIREDFAHSCAECKPRPLDRQKAIERTLRLRNVVVQEELVDKKPKRPPSKSHKKKAKPADVQTNIPQG
PSDGGKHGSPGEQHPPAKKSKSAHRSSHSVSSQPSKRSPPNPAHPPSPATTPPDLPDDFQIHHYSAGFCALYNEQ
DVPDTHNNAFASLAIPTALSRWLREPDTMKYEVGRSHTEVFQTLPTSADEKRPKLEVKDSTRSLSPGTNLRWRSV
KSTSPIDKDVPLIELNGEIGFQKDYCAEPDNLWTDLSSPLPFVFFHPILPLYIDTRKEGSLARYVRRSCKPNAQL
DTYLSDGSEYHFWLVSDRYISANEQITLPWDFRLEKSVHTRWLHLLGLSDDDSAAQDELELDESEYTAISNWIDR
ILSEYGGCACDLDNNCAFARFHRHYLHGKNQGRPVKKKARKSRNRTISPTSTSHATNSRAASESHANDNADHEAR
NETNPSRSKPPSRDRTPLQGQFDQLGILTEPTDRDKRKVAMVEDSFRRMEQQQPPRKKKRVSDGTATAAPATTTK
PKSRNGSAAPPGRYTDAGTSSRSKSGSPASVRSPNPANATASAHTTSAFASRLRQPSVGLRPTYCDASVQTDPVE
GEWFSEPSKPHGPKKRIISLSKRLLNSRLKNRTGEEERKRRSLSGPTTGGENVSDAGSPTGNEKPSVSSSVPDPQ
SPVSQVGEGHVCGSPQAVKAEPAVATGGLEQAKMRTPDLRVQMPPVPAFDASGAMATPLSTSSTAAHSPISGSLP
SPFAPSAVNGIAVTPSPVKKKLSLSDYTKSRMNKAAGKTVGGSAILKPGLASPEEIKVDVTMEPPATEKPDETIS
PSTTATATNGHG*
Coding >Hirsu2|7769
ATGACAGAAAAGTCTGCGCCGTCGCCGACGCAGACTGCGGTTCCCAGTCAAGGCCCCCCGGCCGCGCCGGTAGCA
CCCGTCGCCAAGCACGAGCCGCCCGCCAAGGCTCCCGAGACGGTCGAGGAAGAGCCGTACACAATCAAATGCATC
TGCAACTTCTCTGACGATGACGGCAACACGATATACTGCGAGACGTGCGACACGTGGCAGCACATCGACTGCTTC
TACCCCGACAACCGGGACGAGGCCATACGCGAGGACTTCGCCCACTCGTGTGCCGAGTGCAAGCCGCGCCCTCTA
GACCGGCAAAAGGCGATTGAGCGGACCCTCCGCCTCAGGAACGTCGTCGTGCAGGAGGAGCTCGTCGACAAGAAG
CCCAAGCGGCCCCCGTCCAAGAGCCACAAGAAGAAGGCCAAGCCCGCCGACGTCCAGACAAACATCCCTCAGGGC
CCGTCCGACGGTGGCAAGCACGGTAGCCCGGGCGAGCAACACCCCCCCGCCAAAAAATCAAAATCTGCACATCGC
TCATCACACTCCGTCAGCTCCCAGCCGTCGAAACGCAGCCCGCCGAACCCTGCGCATCCTCCCAGCCCCGCCACC
ACTCCTCCAGACCTGCCCGACGACTTCCAGATCCACCACTATTCCGCCGGGTTCTGCGCCCTGTACAACGAACAG
GATGTTCCCGATACCCACAACAACGCCTTTGCCAGCCTCGCCATCCCCACCGCGCTCTCGCGCTGGCTGCGGGAA
CCCGACACCATGAAGTACGAGGTCGGGCGCTCCCACACTGAAGTGTTCCAGACCCTTCCGACCAGCGCCGACGAG
AAGAGACCGAAGCTGGAAGTCAAGGACTCGACTCGCTCCTTGAGCCCGGGCACCAACCTGCGATGGCGGTCGGTC
AAGTCGACGTCGCCCATCGACAAGGACGTGCCGCTCATCGAGCTCAACGGCGAAATCGGCTTCCAAAAGGACTAC
TGCGCGGAACCCGACAACCTGTGGACTGACCTCTCGTCGCCCCTGCCCTTCGTTTTCTTCCACCCCATCCTTCCG
CTCTACATTGACACGCGGAAAGAGGGCTCTCTCGCCCGCTACGTCAGGAGGAGCTGCAAGCCCAACGCTCAATTG
GACACGTACCTCTCGGACGGATCGGAGTATCACTTTTGGCTCGTCAGCGATCGCTACATCTCGGCCAACGAGCAG
ATCACTCTTCCCTGGGACTTTCGGCTGGAGAAGAGCGTCCACACGCGCTGGCTCCACCTGCTGGGCCTGAGCGAC
GACGACTCCGCCGCGCAGGACGAGCTGGAGCTCGACGAATCGGAGTACACGGCAATCTCGAACTGGATCGACCGG
ATCCTGTCCGAGTACGGCGGCTGCGCTTGTGATCTCGACAACAACTGCGCCTTCGCCCGTTTCCACCGCCACTAT
TTGCACGGCAAAAACCAAGGGCGGCCGGTCAAGAAAAAGGCACGAAAGTCGCGGAATCGTACCATCTCACCAACC
AGCACGAGCCACGCCACCAACAGCCGTGCCGCCAGCGAGTCTCACGCAAACGACAACGCCGACCACGAGGCGAGG
AACGAAACGAACCCGTCACGCAGCAAGCCTCCTAGTAGGGACCGGACGCCGCTGCAAGGGCAGTTTGACCAGCTG
GGAATACTCACGGAGCCCACAGATCGTGACAAGCGGAAGGTGGCCATGGTGGAGGACTCGTTTCGCCGTATGGAG
CAGCAGCAGCCGCCAAGGAAGAAGAAGCGAGTGTCGGATGGCACGGCCACCGCCGCCCCCGCGACGACGACGAAG
CCCAAGTCTCGAAACGGCTCCGCCGCCCCACCGGGTCGGTATACAGATGCCGGCACCTCCAGCAGGAGCAAGTCG
GGCTCTCCAGCGAGCGTGCGATCGCCGAACCCCGCGAACGCGACCGCATCCGCCCACACAACCTCGGCATTCGCC
TCGAGGCTGCGGCAACCGTCCGTTGGCCTGCGGCCGACATACTGCGACGCCTCTGTTCAAACCGACCCGGTCGAG
GGCGAATGGTTTAGCGAGCCGAGCAAGCCGCACGGCCCCAAGAAGCGCATCATTTCGCTGTCGAAGCGTCTGCTC
AACAGCAGGCTGAAGAACCGCACCGGTGAGGAAGAGCGCAAGAGGCGAAGCCTGTCGGGACCAACAACCGGCGGT
GAGAATGTGTCCGACGCCGGTTCTCCCACGGGCAACGAAAAGCCGTCGGTCTCGAGTTCCGTACCTGACCCCCAG
TCGCCCGTCTCGCAAGTGGGAGAAGGACACGTCTGCGGCTCTCCCCAGGCGGTGAAAGCAGAGCCTGCCGTTGCA
ACGGGGGGGCTAGAACAGGCAAAGATGAGGACTCCCGATCTGCGGGTCCAAATGCCCCCCGTCCCAGCCTTCGAC
GCCAGCGGGGCCATGGCAACCCCGCTGTCCACCTCCAGTACGGCGGCACACTCGCCCATTTCCGGCAGTCTACCG
AGCCCGTTCGCGCCGTCGGCCGTCAACGGCATCGCAGTGACGCCGAGCCCGGTCAAGAAGAAGCTCAGCCTCAGC
GATTACACGAAGAGTCGGATGAACAAGGCTGCTGGGAAAACGGTTGGCGGGTCGGCCATTCTCAAGCCTGGGCTG
GCCAGCCCCGAGGAAATCAAGGTCGACGTCACGATGGAACCGCCGGCGACGGAGAAGCCGGATGAGACAATATCC
CCATCGACGACGGCGACGGCGACGAATGGACATGGGTGA
Transcript >Hirsu2|7769
ATGACAGAAAAGTCTGCGCCGTCGCCGACGCAGACTGCGGTTCCCAGTCAAGGCCCCCCGGCCGCGCCGGTAGCA
CCCGTCGCCAAGCACGAGCCGCCCGCCAAGGCTCCCGAGACGGTCGAGGAAGAGCCGTACACAATCAAATGCATC
TGCAACTTCTCTGACGATGACGGCAACACGATATACTGCGAGACGTGCGACACGTGGCAGCACATCGACTGCTTC
TACCCCGACAACCGGGACGAGGCCATACGCGAGGACTTCGCCCACTCGTGTGCCGAGTGCAAGCCGCGCCCTCTA
GACCGGCAAAAGGCGATTGAGCGGACCCTCCGCCTCAGGAACGTCGTCGTGCAGGAGGAGCTCGTCGACAAGAAG
CCCAAGCGGCCCCCGTCCAAGAGCCACAAGAAGAAGGCCAAGCCCGCCGACGTCCAGACAAACATCCCTCAGGGC
CCGTCCGACGGTGGCAAGCACGGTAGCCCGGGCGAGCAACACCCCCCCGCCAAAAAATCAAAATCTGCACATCGC
TCATCACACTCCGTCAGCTCCCAGCCGTCGAAACGCAGCCCGCCGAACCCTGCGCATCCTCCCAGCCCCGCCACC
ACTCCTCCAGACCTGCCCGACGACTTCCAGATCCACCACTATTCCGCCGGGTTCTGCGCCCTGTACAACGAACAG
GATGTTCCCGATACCCACAACAACGCCTTTGCCAGCCTCGCCATCCCCACCGCGCTCTCGCGCTGGCTGCGGGAA
CCCGACACCATGAAGTACGAGGTCGGGCGCTCCCACACTGAAGTGTTCCAGACCCTTCCGACCAGCGCCGACGAG
AAGAGACCGAAGCTGGAAGTCAAGGACTCGACTCGCTCCTTGAGCCCGGGCACCAACCTGCGATGGCGGTCGGTC
AAGTCGACGTCGCCCATCGACAAGGACGTGCCGCTCATCGAGCTCAACGGCGAAATCGGCTTCCAAAAGGACTAC
TGCGCGGAACCCGACAACCTGTGGACTGACCTCTCGTCGCCCCTGCCCTTCGTTTTCTTCCACCCCATCCTTCCG
CTCTACATTGACACGCGGAAAGAGGGCTCTCTCGCCCGCTACGTCAGGAGGAGCTGCAAGCCCAACGCTCAATTG
GACACGTACCTCTCGGACGGATCGGAGTATCACTTTTGGCTCGTCAGCGATCGCTACATCTCGGCCAACGAGCAG
ATCACTCTTCCCTGGGACTTTCGGCTGGAGAAGAGCGTCCACACGCGCTGGCTCCACCTGCTGGGCCTGAGCGAC
GACGACTCCGCCGCGCAGGACGAGCTGGAGCTCGACGAATCGGAGTACACGGCAATCTCGAACTGGATCGACCGG
ATCCTGTCCGAGTACGGCGGCTGCGCTTGTGATCTCGACAACAACTGCGCCTTCGCCCGTTTCCACCGCCACTAT
TTGCACGGCAAAAACCAAGGGCGGCCGGTCAAGAAAAAGGCACGAAAGTCGCGGAATCGTACCATCTCACCAACC
AGCACGAGCCACGCCACCAACAGCCGTGCCGCCAGCGAGTCTCACGCAAACGACAACGCCGACCACGAGGCGAGG
AACGAAACGAACCCGTCACGCAGCAAGCCTCCTAGTAGGGACCGGACGCCGCTGCAAGGGCAGTTTGACCAGCTG
GGAATACTCACGGAGCCCACAGATCGTGACAAGCGGAAGGTGGCCATGGTGGAGGACTCGTTTCGCCGTATGGAG
CAGCAGCAGCCGCCAAGGAAGAAGAAGCGAGTGTCGGATGGCACGGCCACCGCCGCCCCCGCGACGACGACGAAG
CCCAAGTCTCGAAACGGCTCCGCCGCCCCACCGGGTCGGTATACAGATGCCGGCACCTCCAGCAGGAGCAAGTCG
GGCTCTCCAGCGAGCGTGCGATCGCCGAACCCCGCGAACGCGACCGCATCCGCCCACACAACCTCGGCATTCGCC
TCGAGGCTGCGGCAACCGTCCGTTGGCCTGCGGCCGACATACTGCGACGCCTCTGTTCAAACCGACCCGGTCGAG
GGCGAATGGTTTAGCGAGCCGAGCAAGCCGCACGGCCCCAAGAAGCGCATCATTTCGCTGTCGAAGCGTCTGCTC
AACAGCAGGCTGAAGAACCGCACCGGTGAGGAAGAGCGCAAGAGGCGAAGCCTGTCGGGACCAACAACCGGCGGT
GAGAATGTGTCCGACGCCGGTTCTCCCACGGGCAACGAAAAGCCGTCGGTCTCGAGTTCCGTACCTGACCCCCAG
TCGCCCGTCTCGCAAGTGGGAGAAGGACACGTCTGCGGCTCTCCCCAGGCGGTGAAAGCAGAGCCTGCCGTTGCA
ACGGGGGGGCTAGAACAGGCAAAGATGAGGACTCCCGATCTGCGGGTCCAAATGCCCCCCGTCCCAGCCTTCGAC
GCCAGCGGGGCCATGGCAACCCCGCTGTCCACCTCCAGTACGGCGGCACACTCGCCCATTTCCGGCAGTCTACCG
AGCCCGTTCGCGCCGTCGGCCGTCAACGGCATCGCAGTGACGCCGAGCCCGGTCAAGAAGAAGCTCAGCCTCAGC
GATTACACGAAGAGTCGGATGAACAAGGCTGCTGGGAAAACGGTTGGCGGGTCGGCCATTCTCAAGCCTGGGCTG
GCCAGCCCCGAGGAAATCAAGGTCGACGTCACGATGGAACCGCCGGCGACGGAGAAGCCGGATGAGACAATATCC
CCATCGACGACGGCGACGGCGACGAATGGACATGGGTGA
Gene >Hirsu2|7769
ATGACAGAAAAGTCTGCGCCGTCGCCGACGCAGACTGCGGTTCCCAGTCAAGGCCCCCCGGCCGCGCCGGTAGCA
CCCGTCGCCAAGCACGAGCCGCCCGCCAAGGCTCCCGAGACGGTCGAGGAAGAGCCGTACACAATCAAATGCATC
TGCAACTTCTCTGACGATGACGGCAACACGATATACTGCGAGACGTGCGACACGTGGCAGCACATCGACTGCTTC
TACCCCGACAACCGGGACGAGGCCATACGCGAGGACTTCGCCCACTCGTGTGCCGAGTGCAAGCCGCGCCCTCTA
GACCGGCAAAAGGCGATTGAGCGGACCCTCCGCCTCAGGAACGTCGTCGTGCAGGAGGAGCTCGTCGACAAGAAG
CCCAAGCGGCCCCCGTCCAAGAGCCACAAGAAGAAGGCCAAGCCCGCCGACGTCCAGACAAACATCCCTCAGGGC
CCGTCCGACGGTGGCAAGCACGGTAGCCCGGGCGAGCAACACCCCCCCGCCAAAAAATCAAAATCTGCACATCGC
TCATCACACTCCGTCAGCTCCCAGCCGTCGAAACGCAGCCCGCCGAACCCTGCGCATCCTCCCAGCCCCGCCACC
ACTCCTCCAGACCTGCCCGACGACTTCCAGATCCACCACTATTCCGCCGGGTTCTGCGCCCTGTACAACGAACAG
GATGTTCCCGATACCCACAACAACGCCTTTGCCAGCCTCGCCATCCCCACCGCGCTCTCGCGCTGGCTGCGGGAA
CCCGACACCATGAAGTACGAGGTCGGGCGCTCCCACACTGAAGTGTTCCAGACCCTTCCGACCAGCGCCGACGAG
AAGAGACCGAAGCTGGAAGTCAAGGACTCGACTCGCTCCTTGAGCCCGGGCACCAACCTGCGATGGCGGTCGGTC
AAGTCGACGTCGCCCATCGACAAGGACGTGCCGCTCATCGAGCTCAACGGCGAAATCGGCTTCCAAAAGGACTAC
TGCGCGGAACCCGACAACCTGTGGACTGACCTCTCGTCGCCCCTGCCCTTCGTTTTCTTCCACCCCATCCTTCCG
CTCTACATTGACACGCGGAAAGAGGGCTCTCTCGCCCGCTACGTCAGGAGGAGCTGCAAGCCCAACGCTCAATTG
GACACGTACCTCTCGGACGGATCGGAGTATCACTTTTGGCTCGTCAGCGATCGCTACATCTCGGCCAACGAGCAG
ATCACTCTTCCCTGGGACTTTCGGCTGGAGAAGAGCGTCCACACGCGCTGGCTCCACCTGCTGGGCCTGAGCGAC
GACGACTCCGCCGCGCAGGACGAGCTGGAGCTCGACGAATCGGAGTACACGGCAATCTCGAACTGGATCGACCGG
ATCCTGTCCGAGTACGGCGGCTGCGCTTGTGATCTCGACAACAACTGCGCCTTCGCCCGTTTCCACCGCCACTAT
TTGCACGGCAAAAACCAAGGGCGGCCGGTCAAGAAAAAGGCACGAAAGTCGCGGAATCGTACCATCTCACCAACC
AGCACGAGCCACGCCACCAACAGCCGTGCCGCCAGCGAGTCTCACGCAAACGACAACGCCGACCACGAGGCGAGG
AACGAAACGAACCCGTCACGCAGCAAGCCTCCTAGTAGGGACCGGACGCCGCTGCAAGGGCAGTTTGACCAGCTG
GGAATACTCACGGAGCCCACAGATCGTGACAAGCGGAAGGTGGCCATGGTGGAGGACTCGTTTCGCCGTATGGAG
CAGCAGCAGCCGCCAAGGAAGAAGAAGCGAGTGTCGGATGGCACGGCCACCGCCGCCCCCGCGACGACGACGAAG
CCCAAGTCTCGAAACGGCTCCGCCGCCCCACCGGGTCGGTATACAGATGCCGGCACCTCCAGCAGGAGCAAGTCG
GGCTCTCCAGCGAGCGTGCGATCGCCGAACCCCGCGAACGCGACCGCATCCGCCCACACAACCTCGGCATTCGCC
TCGAGGCTGCGGCAACCGTCCGTTGGCCTGCGGCCGACATACTGCGACGCCTCTGTTCAAACCGACCCGGTCGAG
GGCGAATGGTTTAGCGAGCCGAGCAAGCCGCACGGCCCCAAGAAGCGCATCATTTCGCTGTCGAAGCGTCTGCTC
AACAGCAGGCTGAAGAACCGCACCGGTGAGGAAGAGCGCAAGAGGCGAAGCCTGTCGGGACCAACAACCGGCGGT
GAGAATGTGTCCGACGCCGGTTCTCCCACGGGCAACGAAAAGCCGTCGGTCTCGAGTTCCGTACCTGACCCCCAG
TCGCCCGTCTCGCAAGTGGGAGAAGGACACGTCTGCGGCTCTCCCCAGGCGGTGAAAGCAGAGCCTGCCGTTGCA
ACGGGGGGGCTAGAACAGGCAAAGATGAGGACTCCCGATCTGCGGGTCCAAATGCCCCCCGTCCCAGCCTTCGAC
GCCAGCGGGGCCATGGCAACCCCGCTGTCCACCTCCAGTACGGCGGCACACTCGCCCATTTCCGGCAGTCTACCG
AGCCCGTTCGCGCCGTCGGCCGTCAACGGCATCGCAGTGACGCCGAGCCCGGTCAAGAAGAAGCTCAGCCTCAGC
GATTACACGAAGAGTCGGATGAACAAGGCTGCTGGGAAAACGGTTGGCGGGTCGGCCATTCTCAAGCCTGGGCTG
GCCAGCCCCGAGGAAATCAAGGTCGACGTCACGATGGAACCGCCGGCGACGGAGAAGCCGGATGAGACAATATCC
CCATCGACGACGGCGACGGCGACGAATGGACATGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail