Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7765
Gene name
LocationContig_470:5716..7163
Strand-
Gene length (bp)1447
Transcript length (bp)1377
Coding sequence length (bp)1377
Protein length (aa) 459

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10332 DUF2418 Protein of unknown function (DUF2418) 3.8E-35 161 265

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P87236|MU154_SCHPO Meiotically up-regulated gene 154 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug154 PE=1 SV=1 1 342 1.0E-18

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 79 101 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7765
MPRLVRRRPLWERIVSMLNPMDFLLWLSEEIETRDWDSQLVGTQLGLGLNFVFLLARANSGSATTGEDIFGDGGS
AGWLSLIVYPLVWALVAFSLTNAVYAVCRTRRYRLFEASIETKPSTPSARRVRVQSSPVSSSPLRFIADMMTPES
AESRAHPDTNKDVWELAVWDPLPVSIRISCFFSPGHVLVYLLSLPLAPLDPRPSMTVLNTLVVQLVLSAQLLLLC
ARYSQQAKDTSIIQKEVMHEYNTKFVQPRLFPQVRDVGTQVSADEPTEPLGSVQVGTPTTLVRRAFKTHGNPYID
SPESTPVSGSTGFLKPPMLTPPAASRRIESLAPSTSQRGGSALRNSLPASRSPAAGTPPPFSGGNPNFGGNMGVY
THNKSPLKKATSLGDFNQADAPPPRNSREMAAFEQRGLEPPSSPTKQTDRRKTLAASTQAAAPRPFTGVARPRPQ
YERYPSRW*
Coding >Hirsu2|7765
ATGCCCCGACTCGTGCGCCGCCGGCCGCTCTGGGAGCGCATCGTGTCGATGCTGAACCCTATGGACTTTCTGCTC
TGGCTGTCGGAGGAGATCGAGACGAGGGACTGGGACTCGCAGCTGGTCGGCACGCAGCTCGGGCTGGGCCTCAAC
TTCGTCTTCCTGCTGGCGCGGGCCAACTCGGGGTCGGCGACAACTGGCGAGGACATATTTGGCGATGGCGGCAGC
GCCGGCTGGCTGTCTCTGATTGTCTACCCCTTGGTCTGGGCTCTGGTCGCATTCTCCCTGACCAACGCCGTCTAC
GCCGTCTGTCGGACGAGGAGATACCGCTTGTTTGAGGCGAGCATCGAGACGAAGCCCTCGACGCCCTCGGCGCGC
CGGGTCCGCGTCCAGTCGTCGCCCGTATCGTCGTCGCCGCTGCGCTTCATTGCCGACATGATGACGCCCGAGTCG
GCCGAGTCGCGAGCGCACCCGGATACGAACAAGGACGTTTGGGAGCTGGCGGTTTGGGACCCGCTCCCGGTGTCT
ATTCGCATCTCTTGCTTCTTCAGCCCGGGCCACGTCCTCGTCTATCTGCTCTCGCTGCCGCTCGCGCCTCTCGAT
CCCCGGCCCAGCATGACGGTGCTCAACACGTTGGTCGTGCAGCTCGTCCTCTCGGCGCAGTTGCTGCTGCTCTGC
GCGCGCTACTCCCAGCAGGCCAAGGACACGTCGATTATCCAGAAAGAGGTGATGCACGAATACAACACCAAGTTC
GTCCAGCCCCGGCTGTTCCCGCAAGTCAGGGATGTGGGGACCCAAGTGAGCGCGGACGAGCCGACCGAGCCTCTC
GGATCGGTACAGGTCGGCACCCCGACGACGCTGGTCAGGCGCGCCTTCAAGACGCACGGGAACCCGTACATCGAC
TCCCCCGAGTCCACCCCGGTCAGCGGCAGCACCGGCTTCCTGAAGCCGCCGATGCTCACGCCTCCCGCCGCAAGC
CGTCGGATAGAGTCGCTGGCACCGTCCACCAGCCAGCGCGGCGGCTCGGCTCTCCGCAACAGCCTGCCCGCGAGC
CGTAGCCCAGCGGCCGGCACGCCCCCGCCCTTCTCGGGAGGCAACCCGAACTTTGGGGGGAACATGGGCGTCTAC
ACCCACAACAAGTCGCCGCTCAAGAAGGCGACCAGCCTCGGCGATTTCAACCAGGCCGACGCGCCGCCGCCGAGA
AACTCGAGAGAAATGGCTGCCTTTGAGCAGCGGGGCCTCGAGCCCCCGAGCAGCCCGACGAAGCAGACAGACCGT
AGGAAGACTCTGGCTGCAAGCACGCAGGCTGCCGCCCCTCGTCCATTCACGGGCGTGGCCAGACCCAGGCCGCAG
TATGAGAGATACCCGTCGCGATGGTAG
Transcript >Hirsu2|7765
ATGCCCCGACTCGTGCGCCGCCGGCCGCTCTGGGAGCGCATCGTGTCGATGCTGAACCCTATGGACTTTCTGCTC
TGGCTGTCGGAGGAGATCGAGACGAGGGACTGGGACTCGCAGCTGGTCGGCACGCAGCTCGGGCTGGGCCTCAAC
TTCGTCTTCCTGCTGGCGCGGGCCAACTCGGGGTCGGCGACAACTGGCGAGGACATATTTGGCGATGGCGGCAGC
GCCGGCTGGCTGTCTCTGATTGTCTACCCCTTGGTCTGGGCTCTGGTCGCATTCTCCCTGACCAACGCCGTCTAC
GCCGTCTGTCGGACGAGGAGATACCGCTTGTTTGAGGCGAGCATCGAGACGAAGCCCTCGACGCCCTCGGCGCGC
CGGGTCCGCGTCCAGTCGTCGCCCGTATCGTCGTCGCCGCTGCGCTTCATTGCCGACATGATGACGCCCGAGTCG
GCCGAGTCGCGAGCGCACCCGGATACGAACAAGGACGTTTGGGAGCTGGCGGTTTGGGACCCGCTCCCGGTGTCT
ATTCGCATCTCTTGCTTCTTCAGCCCGGGCCACGTCCTCGTCTATCTGCTCTCGCTGCCGCTCGCGCCTCTCGAT
CCCCGGCCCAGCATGACGGTGCTCAACACGTTGGTCGTGCAGCTCGTCCTCTCGGCGCAGTTGCTGCTGCTCTGC
GCGCGCTACTCCCAGCAGGCCAAGGACACGTCGATTATCCAGAAAGAGGTGATGCACGAATACAACACCAAGTTC
GTCCAGCCCCGGCTGTTCCCGCAAGTCAGGGATGTGGGGACCCAAGTGAGCGCGGACGAGCCGACCGAGCCTCTC
GGATCGGTACAGGTCGGCACCCCGACGACGCTGGTCAGGCGCGCCTTCAAGACGCACGGGAACCCGTACATCGAC
TCCCCCGAGTCCACCCCGGTCAGCGGCAGCACCGGCTTCCTGAAGCCGCCGATGCTCACGCCTCCCGCCGCAAGC
CGTCGGATAGAGTCGCTGGCACCGTCCACCAGCCAGCGCGGCGGCTCGGCTCTCCGCAACAGCCTGCCCGCGAGC
CGTAGCCCAGCGGCCGGCACGCCCCCGCCCTTCTCGGGAGGCAACCCGAACTTTGGGGGGAACATGGGCGTCTAC
ACCCACAACAAGTCGCCGCTCAAGAAGGCGACCAGCCTCGGCGATTTCAACCAGGCCGACGCGCCGCCGCCGAGA
AACTCGAGAGAAATGGCTGCCTTTGAGCAGCGGGGCCTCGAGCCCCCGAGCAGCCCGACGAAGCAGACAGACCGT
AGGAAGACTCTGGCTGCAAGCACGCAGGCTGCCGCCCCTCGTCCATTCACGGGCGTGGCCAGACCCAGGCCGCAG
TATGAGAGATACCCGTCGCGATGGTAG
Gene >Hirsu2|7765
ATGCCCCGACTCGTGCGCCGCCGGCCGCTCTGGGAGCGCATCGTGTCGATGCTGAACCCTATGGACTTTCTGCTC
TGGCTGTCGGAGGAGATCGAGACGAGGGACTGGGACTCGCAGCTGGTCGGCACGCAGCTCGGGCTGGGCCTCAAC
TTCGTCTTCCTGCTGGCGCGGGCCAACTCGGGGTCGGCGACAACTGGCGAGGACATATTTGGCGATGGCGGCAGC
GCCGGCTGGCTGTCTCTGATTGTGAGCTGATGCAGGCCTCTCTCCCTTGCCCTCTGCCGCGACTCGGTGGCTGAC
CGCCCTTCTTCCGCAGGTCTACCCCTTGGTCTGGGCTCTGGTCGCATTCTCCCTGACCAACGCCGTCTACGCCGT
CTGTCGGACGAGGAGATACCGCTTGTTTGAGGCGAGCATCGAGACGAAGCCCTCGACGCCCTCGGCGCGCCGGGT
CCGCGTCCAGTCGTCGCCCGTATCGTCGTCGCCGCTGCGCTTCATTGCCGACATGATGACGCCCGAGTCGGCCGA
GTCGCGAGCGCACCCGGATACGAACAAGGACGTTTGGGAGCTGGCGGTTTGGGACCCGCTCCCGGTGTCTATTCG
CATCTCTTGCTTCTTCAGCCCGGGCCACGTCCTCGTCTATCTGCTCTCGCTGCCGCTCGCGCCTCTCGATCCCCG
GCCCAGCATGACGGTGCTCAACACGTTGGTCGTGCAGCTCGTCCTCTCGGCGCAGTTGCTGCTGCTCTGCGCGCG
CTACTCCCAGCAGGCCAAGGACACGTCGATTATCCAGAAAGAGGTGATGCACGAATACAACACCAAGTTCGTCCA
GCCCCGGCTGTTCCCGCAAGTCAGGGATGTGGGGACCCAAGTGAGCGCGGACGAGCCGACCGAGCCTCTCGGATC
GGTACAGGTCGGCACCCCGACGACGCTGGTCAGGCGCGCCTTCAAGACGCACGGGAACCCGTACATCGACTCCCC
CGAGTCCACCCCGGTCAGCGGCAGCACCGGCTTCCTGAAGCCGCCGATGCTCACGCCTCCCGCCGCAAGCCGTCG
GATAGAGTCGCTGGCACCGTCCACCAGCCAGCGCGGCGGCTCGGCTCTCCGCAACAGCCTGCCCGCGAGCCGTAG
CCCAGCGGCCGGCACGCCCCCGCCCTTCTCGGGAGGCAACCCGAACTTTGGGGGGAACATGGGCGTCTACACCCA
CAACAAGTCGCCGCTCAAGAAGGCGACCAGCCTCGGCGATTTCAACCAGGCCGACGCGCCGCCGCCGAGAAACTC
GAGAGAAATGGCTGCCTTTGAGCAGCGGGGCCTCGAGCCCCCGAGCAGCCCGACGAAGCAGACAGACCGTAGGAA
GACTCTGGCTGCAAGCACGCAGGCTGCCGCCCCTCGTCCATTCACGGGCGTGGCCAGACCCAGGCCGCAGTATGA
GAGATACCCGTCGCGATGGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail