Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7757
Gene name
LocationContig_47:41216..42894
Strand-
Gene length (bp)1678
Transcript length (bp)1281
Coding sequence length (bp)1281
Protein length (aa) 427

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 8.0E-06 18 46

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B1Y1|A2462_ARTBC Probable FAD-dependent monooxygenase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02462 PE=3 SV=1 9 411 2.0E-25
sp|A3Q339|MHPA_MYCSJ 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium sp. (strain JLS) GN=mhpA PE=3 SV=1 5 357 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7757
MDTGPAAESATSTKTVAVIGAGLTGLLAAHGLKKHGFRAVVFERDAGLEARPRDWSMLVHWARPVFESLLPGDVL
AELPSALCNPYLGAGELEAAESLPCYSGTDGRLLFRSATPGARRVSRRALRRLLARHVDVRWGCALERLEVTADD
GHVRLAFRRADGKDAGDVDGGGGGEEEEMAFRADFVLGADGSASAVRRLLLRSDDDARPRPSGYVMATGIARYGD
EAQVRAVVETHPVAALMMGGGAVGGIGTLAVDDPHDLSTWTTFWVKIWRASSPRLRGAEALRFVRDRTSPLLGVF
QSAIDWTADDSQVYIDEMKYWVPVPWDNHGGRVTLAGDAAHPMLIYRGQGLQHAIVDVQRYVAGLVRLRASGGDE
ERSAVMGAYDDELVARGAAAVRQSLDEADKSLTVDAIRTMRMATQGHGQSA*
Coding >Hirsu2|7757
ATGGACACGGGTCCCGCGGCTGAGTCTGCGACAAGCACGAAGACGGTTGCCGTCATCGGCGCCGGGCTGACGGGC
CTCCTCGCTGCACACGGCTTGAAAAAGCACGGATTCCGCGCCGTCGTCTTCGAGCGCGACGCCGGGCTCGAGGCG
CGGCCGCGCGACTGGTCGATGCTGGTGCACTGGGCGCGGCCAGTGTTCGAGAGCCTGCTGCCGGGCGACGTGCTG
GCGGAGCTGCCGTCGGCCCTGTGCAACCCGTACCTTGGCGCAGGCGAGCTGGAGGCGGCCGAAAGCCTGCCGTGC
TACAGCGGGACTGACGGCCGGCTGCTCTTCCGCAGCGCCACTCCAGGAGCCCGACGGGTGAGCCGGCGCGCGCTG
CGGCGGCTGCTGGCACGACACGTCGACGTGCGCTGGGGGTGCGCGCTGGAGCGGCTCGAGGTCACGGCCGACGAC
GGTCACGTCCGGCTCGCGTTCCGGCGGGCGGACGGCAAGGACGCGGGGGACGTGGACGGAGGAGGCGGCGGGGAG
GAGGAGGAGATGGCGTTCCGGGCCGACTTTGTGCTCGGCGCCGACGGCTCGGCGTCGGCGGTCCGACGGCTGCTC
CTCCGGTCCGACGACGACGCGCGGCCGAGGCCGTCCGGCTACGTCATGGCGACGGGCATCGCCCGGTACGGCGAC
GAGGCCCAGGTCCGGGCCGTTGTCGAGACGCACCCGGTGGCGGCGCTGATGATGGGCGGCGGCGCCGTGGGAGGC
ATCGGCACGCTGGCCGTCGACGACCCGCACGACCTCTCGACCTGGACGACCTTCTGGGTCAAGATCTGGCGGGCG
TCGTCGCCGCGGCTGCGCGGGGCCGAGGCGCTCCGCTTCGTCCGCGACAGGACAAGCCCGCTGCTGGGCGTCTTC
CAGTCGGCCATCGACTGGACGGCCGACGACAGCCAGGTCTACATCGACGAGATGAAGTACTGGGTCCCGGTGCCG
TGGGACAACCACGGCGGGCGCGTGACGCTGGCGGGCGATGCGGCGCACCCCATGCTCATATATCGCGGACAGGGC
CTCCAGCACGCCATCGTGGACGTGCAGCGGTACGTGGCCGGGCTGGTGAGGCTGCGGGCGAGCGGCGGCGACGAG
GAGCGGTCGGCCGTCATGGGCGCCTACGACGACGAGTTGGTGGCGCGCGGGGCGGCGGCGGTGCGGCAGTCGCTC
GACGAGGCCGACAAGTCGCTGACGGTGGACGCGATCCGGACGATGCGCATGGCGACGCAGGGCCACGGGCAGAGC
GCCTGA
Transcript >Hirsu2|7757
ATGGACACGGGTCCCGCGGCTGAGTCTGCGACAAGCACGAAGACGGTTGCCGTCATCGGCGCCGGGCTGACGGGC
CTCCTCGCTGCACACGGCTTGAAAAAGCACGGATTCCGCGCCGTCGTCTTCGAGCGCGACGCCGGGCTCGAGGCG
CGGCCGCGCGACTGGTCGATGCTGGTGCACTGGGCGCGGCCAGTGTTCGAGAGCCTGCTGCCGGGCGACGTGCTG
GCGGAGCTGCCGTCGGCCCTGTGCAACCCGTACCTTGGCGCAGGCGAGCTGGAGGCGGCCGAAAGCCTGCCGTGC
TACAGCGGGACTGACGGCCGGCTGCTCTTCCGCAGCGCCACTCCAGGAGCCCGACGGGTGAGCCGGCGCGCGCTG
CGGCGGCTGCTGGCACGACACGTCGACGTGCGCTGGGGGTGCGCGCTGGAGCGGCTCGAGGTCACGGCCGACGAC
GGTCACGTCCGGCTCGCGTTCCGGCGGGCGGACGGCAAGGACGCGGGGGACGTGGACGGAGGAGGCGGCGGGGAG
GAGGAGGAGATGGCGTTCCGGGCCGACTTTGTGCTCGGCGCCGACGGCTCGGCGTCGGCGGTCCGACGGCTGCTC
CTCCGGTCCGACGACGACGCGCGGCCGAGGCCGTCCGGCTACGTCATGGCGACGGGCATCGCCCGGTACGGCGAC
GAGGCCCAGGTCCGGGCCGTTGTCGAGACGCACCCGGTGGCGGCGCTGATGATGGGCGGCGGCGCCGTGGGAGGC
ATCGGCACGCTGGCCGTCGACGACCCGCACGACCTCTCGACCTGGACGACCTTCTGGGTCAAGATCTGGCGGGCG
TCGTCGCCGCGGCTGCGCGGGGCCGAGGCGCTCCGCTTCGTCCGCGACAGGACAAGCCCGCTGCTGGGCGTCTTC
CAGTCGGCCATCGACTGGACGGCCGACGACAGCCAGGTCTACATCGACGAGATGAAGTACTGGGTCCCGGTGCCG
TGGGACAACCACGGCGGGCGCGTGACGCTGGCGGGCGATGCGGCGCACCCCATGCTCATATATCGCGGACAGGGC
CTCCAGCACGCCATCGTGGACGTGCAGCGGTACGTGGCCGGGCTGGTGAGGCTGCGGGCGAGCGGCGGCGACGAG
GAGCGGTCGGCCGTCATGGGCGCCTACGACGACGAGTTGGTGGCGCGCGGGGCGGCGGCGGTGCGGCAGTCGCTC
GACGAGGCCGACAAGTCGCTGACGGTGGACGCGATCCGGACGATGCGCATGGCGACGCAGGGCCACGGGCAGAGC
GCCTGA
Gene >Hirsu2|7757
ATGGACACGGGTCCCGCGGCTGAGTCTGCGACAAGCACGAAGACGGTTGCCGTCATCGGCGCCGGGCTGACGGGC
CTCCTCGCTGCACACGGCTTGAAAAAGGTGAGAGGGAGACAGGAGAGGCGGCAGAAGAAGAGGAGACGGGGAAGA
CAGAGGAAGAAAAGAAGAAAAAAACATGGTCTCCCACCCCCCTTCCCGGCCCAAAACATAGCGGTGACGCAAGAG
GAGGCCGAGGCTTCAGCTCAAGGGGGCCGGTTTTCGTCCGACACGGCTGATTTTTGACCGATTCTTTTTTCCGCA
GCACGGATTCCGCGCCGTCGTCTTCGAGCGCGACGCCGGGCTCGAGGCGCGGCCGCGCGACTGGTCGATGCTGGT
GCACTGGGCGCGGCCAGTGTTCGAGAGCCTGCTGCCGGGCGACGTGCTGGCGGAGCTGCCGTCGGCCCTGTGCAA
CCCGTACCTTGGCGCAGGCGAGCTGGAGGCGGCCGAAAGCCTGCCGTGCTACAGCGGGACTGACGGCCGGCTGCT
CTTCCGCAGCGCCACTCCAGGAGCCCGACGGGTGAGCCGGCGCGCGCTGCGGCGGCTGCTGGCACGACACGTCGA
CGTGCGCTGGGGGTGCGCGCTGGAGCGGCTCGAGGTCACGGCCGACGACGGTCACGTCCGGCTCGCGTTCCGGCG
GGCGGACGGCAAGGACGCGGGGGACGTGGACGGAGGAGGCGGCGGGGAGGAGGAGGAGATGGCGTTCCGGGCCGA
CTTTGTGCTCGGCGCCGACGGCTCGGCGTCGGCGGTCCGACGGCTGCTCCTCCGGTCCGACGACGACGCGCGGCC
GAGGCCGTCCGGCTACGTCATGGCGACGGGCATCGCCCGGTACGGCGACGAGGCCCAGGTCCGGGCCGTTGTCGA
GACGCACCCGGTGGCGGCGCTGATGATGGGCGGCGGCGCCGTGGGAGGCATCGGCAGTACGTCTTGGCCTTGTCG
CCCCTTGCGCCTCTTCCAAGCTGACGGTCGGCCGGTGCAGCGCTGGCCGTCGACGACCCGCACGACCTCTCGACC
TGGACGACCTTCTGGGTCAAGATCTGGCGGGCGTCGTCGCCGCGGCTGCGCGGGGCCGAGGCGCTCCGCTTCGTC
CGCGACAGGACAAGCCCGCTGCTGGGCGTCTTCCAGTCGGCCATCGACTGGACGGCCGACGACAGCCAGGTCTAC
ATCGACGAGATGAAGTACTGGGTCCCGGTGCCGTGGGACAACCACGGCGGGCGCGTGACGCTGGCGGGCGATGCG
GCGCACCCCATGCTCATATGTAAGACATATCCATCCTCTCCCTTCCCCCTGTTCTTTCTATTTTTTTTTTTTCCT
TTTCTTCGTCCCTTTTCGAAAGAGGAGGGAGAGAGCAGTCAGCCCACAGCATCGGTTCGGGAATGACCAAAAAAA
AAAAACAGATCGCGGACAGGGCCTCCAGCACGCCATCGTGGACGTGCAGCGGTACGTGGCCGGGCTGGTGAGGCT
GCGGGCGAGCGGCGGCGACGAGGAGCGGTCGGCCGTCATGGGCGCCTACGACGACGAGTTGGTGGCGCGCGGGGC
GGCGGCGGTGCGGCAGTCGCTCGACGAGGCCGACAAGTCGCTGACGGTGGACGCGATCCGGACGATGCGCATGGC
GACGCAGGGCCACGGGCAGAGCGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail