Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|775
Gene name
LocationContig_116:5130..7763
Strand+
Gene length (bp)2633
Transcript length (bp)2583
Coding sequence length (bp)2583
Protein length (aa) 861

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 4.8E-18 52 255

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0090729 toxin activity Yes
GO:0005615 extracellular space Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.2913 0.1995 0.6109 0.134 0.4578 0.2764 0.1272 0.1348 0.3116 0.042

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup319
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|2443
Ophiocordyceps australis map64 (Brazil) OphauB2|5230
Ophiocordyceps australis map64 (Brazil) OphauB2|5625
Ophiocordyceps camponoti-rufipedis Ophun1|2420
Ophiocordyceps kimflemingae Ophio5|5926
Ophiocordyceps subramaniannii Hirsu2|2503
Ophiocordyceps subramaniannii Hirsu2|5702
Ophiocordyceps subramaniannii Hirsu2|6937
Ophiocordyceps subramaniannii Hirsu2|775 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9312

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|775
MSPEPSMHGVSPQPETEPEQPSTGAKPKQFKPKKEGKKVRTRPKFKPKEGVNVLYRGDSRPASAIEGVGGFYTRP
ESSFPSSSEATPRDPEKAWSLFQHVTNKKDGLTKFISTSLDPYAAWEFGKPSGNLYLIAPDKQMVSVRDTLDGTL
DDRFMEEWEYAAVGQIPWEQVKGHWKKADLRPSDLIALREGKEIDKPFVANPEFNAQKFQSTESSGARPDLAGFP
KGDPNWKDGRFSKYEKDKPSANLKKFVLEVVCGKNAQCAENYLAPRCVETDLRKRAEGICSSGEEEEEAEEEAAE
EEEGSGGEKEEAAGEDGPGKEAQGGDGSGKEAESGAESGAESGAARGGKAMKSEPASVDVAEKESASEFEQLARN
YGLESVAKRKWKRPLSEVRTRNLGYQPLSGSGGKGIGRPTFRPRGRLLSAGGKALGAAGYAFWVEGVVDAFVNDA
STSDKVAAVTSIMPLVGCTAQLAANIDNDRLGGFEVLDTALCYIGDGLVIGGLWPLGLIVHLSRFIISLVRVWLE
PEEPSEEHLKQIQAARDGPWSRFMEEYMGGYLASDGLGDQLGSAIAIDSLAILSDGAWAIGVLTAAQDKAVHMTD
NQTEQAQMREFFPARIAHVRQQLATAIPHRQRAFLLRLVGRLQNDSKLSIKTVADQYNKDFLDGLSKNGTVEVHE
KIRQHLAREPLPPLGAVKTAYLIGQAMGPYAKMPDDEVEKLLTLPDEPTSAPDAKAVAQDGAATDGWEINPLALS
LPVYLGEKGVSDEDGRAASIRLALAVVRHLKGEAGEDETAGLDAALASDLRLLIAMKLGREFDSGAAEGGQTKTK
KTTALAAEAAADPAAAVAKVLGLEKKDVEAVAGNK*
Coding >Hirsu2|775
ATGAGTCCCGAGCCATCCATGCACGGGGTCTCGCCGCAGCCGGAGACGGAACCCGAGCAGCCGTCGACGGGGGCT
AAGCCCAAGCAGTTCAAGCCAAAGAAGGAGGGGAAGAAGGTACGGACGCGTCCAAAGTTCAAGCCAAAAGAGGGC
GTCAACGTCCTGTATCGCGGCGACAGCCGACCCGCGTCAGCGATCGAGGGTGTGGGCGGCTTCTACACCCGGCCG
GAATCGAGCTTTCCGTCGTCGTCCGAGGCCACGCCGAGGGATCCGGAGAAGGCCTGGAGTCTGTTCCAGCACGTG
ACGAACAAGAAGGACGGCTTGACCAAGTTCATCTCCACCTCGTTGGATCCGTACGCGGCGTGGGAATTCGGCAAG
CCATCCGGCAATCTCTACCTGATCGCCCCGGACAAGCAGATGGTCAGCGTGAGGGATACGCTCGACGGGACGCTC
GACGACCGCTTCATGGAAGAGTGGGAGTACGCGGCGGTAGGGCAGATACCGTGGGAACAGGTCAAGGGACACTGG
AAAAAGGCGGACCTCAGGCCTTCGGACCTGATAGCTCTGCGAGAGGGCAAGGAGATCGACAAGCCGTTCGTGGCC
AACCCCGAATTCAACGCGCAGAAGTTCCAGTCGACGGAGTCGTCCGGGGCCCGGCCCGATCTCGCCGGCTTCCCC
AAAGGCGACCCGAATTGGAAGGACGGGCGCTTCTCGAAATATGAGAAGGACAAACCGTCGGCCAACTTGAAGAAG
TTCGTCTTGGAAGTCGTCTGCGGAAAGAACGCGCAATGCGCAGAGAACTATCTGGCTCCCCGATGCGTCGAGACG
GACCTTCGGAAGAGGGCAGAGGGGATATGCAGCTCCGGCGAGGAAGAGGAGGAGGCTGAGGAGGAGGCTGCCGAG
GAGGAGGAGGGGAGCGGCGGAGAGAAGGAGGAGGCGGCGGGCGAGGACGGGCCGGGTAAGGAGGCGCAGGGCGGG
GACGGGTCGGGTAAAGAGGCTGAGAGCGGGGCCGAGAGCGGGGCCGAGAGCGGGGCCGCGAGAGGGGGGAAAGCC
ATGAAGTCCGAGCCGGCGTCTGTGGATGTGGCCGAGAAGGAATCGGCCAGCGAGTTCGAGCAGCTCGCCCGGAAC
TACGGGCTGGAGTCTGTGGCCAAGCGGAAGTGGAAGCGGCCGTTGTCCGAGGTCCGGACGCGCAACCTGGGCTAC
CAGCCTCTCTCGGGCTCGGGCGGCAAGGGGATCGGCAGGCCGACCTTCAGGCCGCGCGGCAGGCTCCTCTCGGCC
GGCGGCAAGGCCCTGGGCGCGGCCGGCTACGCCTTCTGGGTGGAAGGCGTGGTGGACGCGTTCGTCAACGACGCC
AGCACGTCAGACAAGGTGGCGGCGGTGACGTCCATCATGCCGCTGGTCGGCTGCACGGCGCAGCTGGCGGCCAAC
ATCGACAACGACCGCCTCGGCGGCTTCGAGGTGCTGGACACGGCGCTGTGCTACATCGGCGACGGCCTGGTCATC
GGCGGCCTCTGGCCGCTGGGCCTGATCGTGCACCTCAGCCGCTTCATCATCTCGCTGGTGCGCGTCTGGCTCGAG
CCGGAGGAGCCGAGCGAGGAGCACCTGAAGCAGATCCAGGCGGCGCGCGACGGGCCCTGGAGCCGCTTCATGGAG
GAGTACATGGGCGGCTACCTGGCCTCGGACGGGCTCGGCGACCAGCTGGGCAGCGCCATCGCCATCGACTCGCTG
GCCATCCTGTCGGACGGCGCCTGGGCCATCGGCGTCCTGACCGCCGCCCAGGACAAGGCCGTCCACATGACGGAC
AACCAGACGGAGCAGGCCCAGATGCGCGAATTCTTCCCGGCCCGCATCGCCCACGTGCGGCAGCAGCTGGCGACG
GCGATCCCGCACCGGCAGCGCGCGTTCCTCCTGCGCCTCGTCGGCCGGCTGCAGAACGACTCCAAGCTGTCGATC
AAGACGGTGGCCGACCAGTACAACAAGGACTTCCTCGACGGCCTGAGCAAGAACGGGACCGTCGAAGTCCACGAA
AAGATCCGCCAGCACCTGGCCCGCGAGCCGCTGCCGCCGCTGGGGGCCGTCAAGACGGCCTATCTCATCGGCCAG
GCCATGGGGCCGTACGCCAAGATGCCGGACGACGAGGTCGAAAAGTTGCTGACCTTGCCGGACGAGCCGACGTCG
GCGCCGGACGCCAAGGCCGTGGCACAAGACGGCGCCGCCACCGATGGCTGGGAGATCAACCCGCTCGCCCTCAGC
CTGCCCGTCTACCTCGGCGAGAAGGGCGTGTCGGACGAGGACGGCCGGGCGGCCAGCATCCGTCTCGCCCTCGCC
GTCGTCCGCCACCTCAAGGGCGAGGCGGGCGAGGACGAGACGGCGGGCCTCGACGCCGCCCTCGCCAGCGACCTC
CGCCTCCTCATCGCCATGAAGCTCGGCAGAGAGTTCGACTCGGGCGCTGCCGAGGGGGGGCAGACGAAGACGAAG
AAGACGACGGCTCTTGCGGCCGAGGCCGCCGCCGACCCGGCCGCCGCTGTTGCGAAAGTTCTTGGGCTTGAGAAG
AAAGATGTCGAGGCCGTGGCCGGCAATAAATAG
Transcript >Hirsu2|775
ATGAGTCCCGAGCCATCCATGCACGGGGTCTCGCCGCAGCCGGAGACGGAACCCGAGCAGCCGTCGACGGGGGCT
AAGCCCAAGCAGTTCAAGCCAAAGAAGGAGGGGAAGAAGGTACGGACGCGTCCAAAGTTCAAGCCAAAAGAGGGC
GTCAACGTCCTGTATCGCGGCGACAGCCGACCCGCGTCAGCGATCGAGGGTGTGGGCGGCTTCTACACCCGGCCG
GAATCGAGCTTTCCGTCGTCGTCCGAGGCCACGCCGAGGGATCCGGAGAAGGCCTGGAGTCTGTTCCAGCACGTG
ACGAACAAGAAGGACGGCTTGACCAAGTTCATCTCCACCTCGTTGGATCCGTACGCGGCGTGGGAATTCGGCAAG
CCATCCGGCAATCTCTACCTGATCGCCCCGGACAAGCAGATGGTCAGCGTGAGGGATACGCTCGACGGGACGCTC
GACGACCGCTTCATGGAAGAGTGGGAGTACGCGGCGGTAGGGCAGATACCGTGGGAACAGGTCAAGGGACACTGG
AAAAAGGCGGACCTCAGGCCTTCGGACCTGATAGCTCTGCGAGAGGGCAAGGAGATCGACAAGCCGTTCGTGGCC
AACCCCGAATTCAACGCGCAGAAGTTCCAGTCGACGGAGTCGTCCGGGGCCCGGCCCGATCTCGCCGGCTTCCCC
AAAGGCGACCCGAATTGGAAGGACGGGCGCTTCTCGAAATATGAGAAGGACAAACCGTCGGCCAACTTGAAGAAG
TTCGTCTTGGAAGTCGTCTGCGGAAAGAACGCGCAATGCGCAGAGAACTATCTGGCTCCCCGATGCGTCGAGACG
GACCTTCGGAAGAGGGCAGAGGGGATATGCAGCTCCGGCGAGGAAGAGGAGGAGGCTGAGGAGGAGGCTGCCGAG
GAGGAGGAGGGGAGCGGCGGAGAGAAGGAGGAGGCGGCGGGCGAGGACGGGCCGGGTAAGGAGGCGCAGGGCGGG
GACGGGTCGGGTAAAGAGGCTGAGAGCGGGGCCGAGAGCGGGGCCGAGAGCGGGGCCGCGAGAGGGGGGAAAGCC
ATGAAGTCCGAGCCGGCGTCTGTGGATGTGGCCGAGAAGGAATCGGCCAGCGAGTTCGAGCAGCTCGCCCGGAAC
TACGGGCTGGAGTCTGTGGCCAAGCGGAAGTGGAAGCGGCCGTTGTCCGAGGTCCGGACGCGCAACCTGGGCTAC
CAGCCTCTCTCGGGCTCGGGCGGCAAGGGGATCGGCAGGCCGACCTTCAGGCCGCGCGGCAGGCTCCTCTCGGCC
GGCGGCAAGGCCCTGGGCGCGGCCGGCTACGCCTTCTGGGTGGAAGGCGTGGTGGACGCGTTCGTCAACGACGCC
AGCACGTCAGACAAGGTGGCGGCGGTGACGTCCATCATGCCGCTGGTCGGCTGCACGGCGCAGCTGGCGGCCAAC
ATCGACAACGACCGCCTCGGCGGCTTCGAGGTGCTGGACACGGCGCTGTGCTACATCGGCGACGGCCTGGTCATC
GGCGGCCTCTGGCCGCTGGGCCTGATCGTGCACCTCAGCCGCTTCATCATCTCGCTGGTGCGCGTCTGGCTCGAG
CCGGAGGAGCCGAGCGAGGAGCACCTGAAGCAGATCCAGGCGGCGCGCGACGGGCCCTGGAGCCGCTTCATGGAG
GAGTACATGGGCGGCTACCTGGCCTCGGACGGGCTCGGCGACCAGCTGGGCAGCGCCATCGCCATCGACTCGCTG
GCCATCCTGTCGGACGGCGCCTGGGCCATCGGCGTCCTGACCGCCGCCCAGGACAAGGCCGTCCACATGACGGAC
AACCAGACGGAGCAGGCCCAGATGCGCGAATTCTTCCCGGCCCGCATCGCCCACGTGCGGCAGCAGCTGGCGACG
GCGATCCCGCACCGGCAGCGCGCGTTCCTCCTGCGCCTCGTCGGCCGGCTGCAGAACGACTCCAAGCTGTCGATC
AAGACGGTGGCCGACCAGTACAACAAGGACTTCCTCGACGGCCTGAGCAAGAACGGGACCGTCGAAGTCCACGAA
AAGATCCGCCAGCACCTGGCCCGCGAGCCGCTGCCGCCGCTGGGGGCCGTCAAGACGGCCTATCTCATCGGCCAG
GCCATGGGGCCGTACGCCAAGATGCCGGACGACGAGGTCGAAAAGTTGCTGACCTTGCCGGACGAGCCGACGTCG
GCGCCGGACGCCAAGGCCGTGGCACAAGACGGCGCCGCCACCGATGGCTGGGAGATCAACCCGCTCGCCCTCAGC
CTGCCCGTCTACCTCGGCGAGAAGGGCGTGTCGGACGAGGACGGCCGGGCGGCCAGCATCCGTCTCGCCCTCGCC
GTCGTCCGCCACCTCAAGGGCGAGGCGGGCGAGGACGAGACGGCGGGCCTCGACGCCGCCCTCGCCAGCGACCTC
CGCCTCCTCATCGCCATGAAGCTCGGCAGAGAGTTCGACTCGGGCGCTGCCGAGGGGGGGCAGACGAAGACGAAG
AAGACGACGGCTCTTGCGGCCGAGGCCGCCGCCGACCCGGCCGCCGCTGTTGCGAAAGTTCTTGGGCTTGAGAAG
AAAGATGTCGAGGCCGTGGCCGGCAATAAATAG
Gene >Hirsu2|775
ATGAGTCCCGAGCCATCCATGCACGGGGTCTCGGTGACTTTTTCAAGGGAAAGAAAAAGAAACAGAAAGAAGGTG
AAAAGCAGCCGCAGCCGGAGACGGAACCCGAGCAGCCGTCGACGGGGGCTAAGCCCAAGCAGTTCAAGCCAAAGA
AGGAGGGGAAGAAGGTACGGACGCGTCCAAAGTTCAAGCCAAAAGAGGGCGTCAACGTCCTGTATCGCGGCGACA
GCCGACCCGCGTCAGCGATCGAGGGTGTGGGCGGCTTCTACACCCGGCCGGAATCGAGCTTTCCGTCGTCGTCCG
AGGCCACGCCGAGGGATCCGGAGAAGGCCTGGAGTCTGTTCCAGCACGTGACGAACAAGAAGGACGGCTTGACCA
AGTTCATCTCCACCTCGTTGGATCCGTACGCGGCGTGGGAATTCGGCAAGCCATCCGGCAATCTCTACCTGATCG
CCCCGGACAAGCAGATGGTCAGCGTGAGGGATACGCTCGACGGGACGCTCGACGACCGCTTCATGGAAGAGTGGG
AGTACGCGGCGGTAGGGCAGATACCGTGGGAACAGGTCAAGGGACACTGGAAAAAGGCGGACCTCAGGCCTTCGG
ACCTGATAGCTCTGCGAGAGGGCAAGGAGATCGACAAGCCGTTCGTGGCCAACCCCGAATTCAACGCGCAGAAGT
TCCAGTCGACGGAGTCGTCCGGGGCCCGGCCCGATCTCGCCGGCTTCCCCAAAGGCGACCCGAATTGGAAGGACG
GGCGCTTCTCGAAATATGAGAAGGACAAACCGTCGGCCAACTTGAAGAAGTTCGTCTTGGAAGTCGTCTGCGGAA
AGAACGCGCAATGCGCAGAGAACTATCTGGCTCCCCGATGCGTCGAGACGGACCTTCGGAAGAGGGCAGAGGGGA
TATGCAGCTCCGGCGAGGAAGAGGAGGAGGCTGAGGAGGAGGCTGCCGAGGAGGAGGAGGGGAGCGGCGGAGAGA
AGGAGGAGGCGGCGGGCGAGGACGGGCCGGGTAAGGAGGCGCAGGGCGGGGACGGGTCGGGTAAAGAGGCTGAGA
GCGGGGCCGAGAGCGGGGCCGAGAGCGGGGCCGCGAGAGGGGGGAAAGCCATGAAGTCCGAGCCGGCGTCTGTGG
ATGTGGCCGAGAAGGAATCGGCCAGCGAGTTCGAGCAGCTCGCCCGGAACTACGGGCTGGAGTCTGTGGCCAAGC
GGAAGTGGAAGCGGCCGTTGTCCGAGGTCCGGACGCGCAACCTGGGCTACCAGCCTCTCTCGGGCTCGGGCGGCA
AGGGGATCGGCAGGCCGACCTTCAGGCCGCGCGGCAGGCTCCTCTCGGCCGGCGGCAAGGCCCTGGGCGCGGCCG
GCTACGCCTTCTGGGTGGAAGGCGTGGTGGACGCGTTCGTCAACGACGCCAGCACGTCAGACAAGGTGGCGGCGG
TGACGTCCATCATGCCGCTGGTCGGCTGCACGGCGCAGCTGGCGGCCAACATCGACAACGACCGCCTCGGCGGCT
TCGAGGTGCTGGACACGGCGCTGTGCTACATCGGCGACGGCCTGGTCATCGGCGGCCTCTGGCCGCTGGGCCTGA
TCGTGCACCTCAGCCGCTTCATCATCTCGCTGGTGCGCGTCTGGCTCGAGCCGGAGGAGCCGAGCGAGGAGCACC
TGAAGCAGATCCAGGCGGCGCGCGACGGGCCCTGGAGCCGCTTCATGGAGGAGTACATGGGCGGCTACCTGGCCT
CGGACGGGCTCGGCGACCAGCTGGGCAGCGCCATCGCCATCGACTCGCTGGCCATCCTGTCGGACGGCGCCTGGG
CCATCGGCGTCCTGACCGCCGCCCAGGACAAGGCCGTCCACATGACGGACAACCAGACGGAGCAGGCCCAGATGC
GCGAATTCTTCCCGGCCCGCATCGCCCACGTGCGGCAGCAGCTGGCGACGGCGATCCCGCACCGGCAGCGCGCGT
TCCTCCTGCGCCTCGTCGGCCGGCTGCAGAACGACTCCAAGCTGTCGATCAAGACGGTGGCCGACCAGTACAACA
AGGACTTCCTCGACGGCCTGAGCAAGAACGGGACCGTCGAAGTCCACGAAAAGATCCGCCAGCACCTGGCCCGCG
AGCCGCTGCCGCCGCTGGGGGCCGTCAAGACGGCCTATCTCATCGGCCAGGCCATGGGGCCGTACGCCAAGATGC
CGGACGACGAGGTCGAAAAGTTGCTGACCTTGCCGGACGAGCCGACGTCGGCGCCGGACGCCAAGGCCGTGGCAC
AAGACGGCGCCGCCACCGATGGCTGGGAGATCAACCCGCTCGCCCTCAGCCTGCCCGTCTACCTCGGCGAGAAGG
GCGTGTCGGACGAGGACGGCCGGGCGGCCAGCATCCGTCTCGCCCTCGCCGTCGTCCGCCACCTCAAGGGCGAGG
CGGGCGAGGACGAGACGGCGGGCCTCGACGCCGCCCTCGCCAGCGACCTCCGCCTCCTCATCGCCATGAAGCTCG
GCAGAGAGTTCGACTCGGGCGCTGCCGAGGGGGGGCAGACGAAGACGAAGAAGACGACGGCTCTTGCGGCCGAGG
CCGCCGCCGACCCGGCCGCCGCTGTTGCGAAAGTTCTTGGGCTTGAGAAGAAAGATGTCGAGGCCGTGGCCGGCA
ATAAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail