Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7748
Gene name
LocationContig_47:18315..19770
Strand-
Gene length (bp)1455
Transcript length (bp)1455
Coding sequence length (bp)1455
Protein length (aa) 485

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 2.2E-60 33 477
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 5.6E-10 28 91

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P49253|AOF_ONCMY Amine oxidase [flavin-containing] OS=Oncorhynchus mykiss GN=mao PE=2 SV=2 25 484 3.0E-85
sp|Q8BW75|AOFB_MOUSE Amine oxidase [flavin-containing] B OS=Mus musculus GN=Maob PE=1 SV=4 25 484 4.0E-83
sp|P19643|AOFB_RAT Amine oxidase [flavin-containing] B OS=Rattus norvegicus GN=Maob PE=1 SV=3 24 484 1.0E-82
sp|Q5RE98|AOFB_PONAB Amine oxidase [flavin-containing] B OS=Pongo abelii GN=MAOB PE=2 SV=3 33 484 7.0E-82
sp|Q54IT3|AOFA_DICDI Probable flavin-containing monoamine oxidase A OS=Dictyostelium discoideum GN=maoA PE=3 SV=1 25 483 1.0E-81
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P49253|AOF_ONCMY Amine oxidase [flavin-containing] OS=Oncorhynchus mykiss GN=mao PE=2 SV=2 25 484 3.0E-85
sp|Q8BW75|AOFB_MOUSE Amine oxidase [flavin-containing] B OS=Mus musculus GN=Maob PE=1 SV=4 25 484 4.0E-83
sp|P19643|AOFB_RAT Amine oxidase [flavin-containing] B OS=Rattus norvegicus GN=Maob PE=1 SV=3 24 484 1.0E-82
sp|Q5RE98|AOFB_PONAB Amine oxidase [flavin-containing] B OS=Pongo abelii GN=MAOB PE=2 SV=3 33 484 7.0E-82
sp|Q54IT3|AOFA_DICDI Probable flavin-containing monoamine oxidase A OS=Dictyostelium discoideum GN=maoA PE=3 SV=1 25 483 1.0E-81
sp|Q6NSN2|AOF_DANRE Amine oxidase [flavin-containing] OS=Danio rerio GN=mao PE=1 SV=1 25 482 4.0E-80
sp|P27338|AOFB_HUMAN Amine oxidase [flavin-containing] B OS=Homo sapiens GN=MAOB PE=1 SV=3 33 484 4.0E-80
sp|P58027|AOFA_CANLF Amine oxidase [flavin-containing] A OS=Canis lupus familiaris GN=MAOA PE=2 SV=1 25 482 7.0E-80
sp|Q7YRB7|AOFB_CANLF Amine oxidase [flavin-containing] B OS=Canis lupus familiaris GN=MAOB PE=2 SV=3 33 484 2.0E-79
sp|Q5NU32|AOFA_HORSE Amine oxidase [flavin-containing] A OS=Equus caballus GN=MAOA PE=2 SV=1 25 482 4.0E-79
sp|Q6Q2J0|AOFA_PIG Amine oxidase [flavin-containing] A OS=Sus scrofa GN=MAOA PE=2 SV=1 24 482 2.0E-78
sp|P21397|AOFA_HUMAN Amine oxidase [flavin-containing] A OS=Homo sapiens GN=MAOA PE=1 SV=1 25 482 3.0E-78
sp|P21398|AOFA_BOVIN Amine oxidase [flavin-containing] A OS=Bos taurus GN=MAOA PE=2 SV=2 22 482 3.0E-78
sp|Q5RE60|AOFA_PONAB Amine oxidase [flavin-containing] A OS=Pongo abelii GN=MAOA PE=2 SV=1 25 482 1.0E-77
sp|Q6PLK3|AOFB_PIG Amine oxidase [flavin-containing] B OS=Sus scrofa GN=MAOB PE=2 SV=3 33 484 1.0E-76
sp|P58028|AOFB_CAVPO Amine oxidase [flavin-containing] B OS=Cavia porcellus GN=MAOB PE=2 SV=2 33 484 2.0E-74
sp|P56560|AOFB_BOVIN Amine oxidase [flavin-containing] B OS=Bos taurus GN=MAOB PE=1 SV=4 33 484 6.0E-74
sp|Q64133|AOFA_MOUSE Amine oxidase [flavin-containing] A OS=Mus musculus GN=Maoa PE=1 SV=3 25 482 8.0E-74
sp|P9WQ15|AOFH_MYCTU Putative flavin-containing monoamine oxidase AofH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=aofH PE=1 SV=1 24 476 5.0E-68
sp|P9WQ14|AOFH_MYCTO Putative flavin-containing monoamine oxidase AofH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=aofH PE=3 SV=1 24 476 5.0E-68
sp|P63534|AOFH_MYCBO Putative flavin-containing monoamine oxidase AofH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=aofH PE=3 SV=1 24 476 5.0E-68
sp|P21396|AOFA_RAT Amine oxidase [flavin-containing] A OS=Rattus norvegicus GN=Maoa PE=1 SV=1 37 482 2.0E-65
sp|Q556K3|AOFB_DICDI Probable flavin-containing monoamine oxidase B OS=Dictyostelium discoideum GN=maoB-1 PE=3 SV=1 21 477 5.0E-57
sp|Q55629|Y782_SYNY3 Uncharacterized protein slr0782 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0782 PE=3 SV=1 24 477 4.0E-54
sp|Q556K4|AOFC_DICDI Probable flavin-containing monoamine oxidase C OS=Dictyostelium discoideum GN=maoC-1 PE=3 SV=1 25 484 5.0E-53
sp|P40974|PUO_KOCRO Putrescine oxidase OS=Kocuria rosea GN=puo PE=1 SV=1 25 477 2.0E-48
sp|A0A024BTN9|OXLA_BOTSC L-amino acid oxidase Bs29 (Fragment) OS=Bothriechis schlegelii PE=1 SV=1 26 484 6.0E-26
sp|J7H670|OXLA_LACMT L-amino acid oxidase Lm29 OS=Lachesis muta PE=1 SV=1 26 484 9.0E-25
sp|B0VXW0|OXLA_SISCA L-amino-acid oxidase OS=Sistrurus catenatus edwardsii PE=2 SV=1 26 484 9.0E-25
sp|K9N7B7|OXLA_CRODM L-amino acid oxidase Cdc18 (Fragment) OS=Crotalus durissus cumanensis PE=1 SV=1 26 484 1.0E-23
sp|O93364|OXLA_CROAD L-amino-acid oxidase OS=Crotalus adamanteus PE=1 SV=1 26 484 1.0E-22
sp|A6MFL0|OXLA_DEMVE L-amino-acid oxidase OS=Demansia vestigiata PE=2 SV=1 26 484 3.0E-22
sp|F8S0Z5|OXLA2_CROAD L-amino-acid oxidase OS=Crotalus adamanteus PE=1 SV=1 26 484 4.0E-22
sp|P56742|OXLA_CROAT L-amino-acid oxidase OS=Crotalus atrox PE=1 SV=2 26 484 4.0E-22
sp|B5AR80|OXLA_BOTPA L-amino-acid oxidase (Fragment) OS=Bothrops pauloensis PE=1 SV=1 26 476 8.0E-22
sp|Q90W54|OXLA_GLOBL L-amino-acid oxidase OS=Gloydius blomhoffii PE=1 SV=1 26 476 2.0E-21
sp|Q6STF1|OXLA_GLOHA L-amino-acid oxidase OS=Gloydius halys PE=1 SV=1 26 476 4.0E-21
sp|A8QL51|OXLA_BUNMU L-amino-acid oxidase OS=Bungarus multicinctus PE=2 SV=1 26 484 5.0E-20
sp|X2JCV5|OXLA_CERCE L-amino acid oxidase OS=Cerastes cerastes PE=1 SV=1 26 484 8.0E-20
sp|X2L4E2|OXLA_BOTPC L-amino acid oxidase (Fragment) OS=Bothrops pictus PE=2 SV=1 26 476 8.0E-20
sp|Q4JHE3|OXLA_OXYSC L-amino-acid oxidase OS=Oxyuranus scutellatus scutellatus PE=2 SV=1 26 484 5.0E-19
sp|P0DI84|OXLA_VIPAA L-amino-acid oxidase OS=Vipera ammodytes ammodytes PE=1 SV=1 26 476 5.0E-19
sp|A8QL52|OXLA_BUNFA L-amino-acid oxidase OS=Bungarus fasciatus PE=1 SV=1 26 484 7.0E-19
sp|B5U6Y8|OXLA_ECHOC L-amino-acid oxidase OS=Echis ocellatus PE=1 SV=1 25 476 8.0E-19
sp|Q96RQ9|OXLA_HUMAN L-amino-acid oxidase OS=Homo sapiens GN=IL4I1 PE=1 SV=1 26 476 2.0E-18
sp|Q4JHE1|OXLA_PSEAU L-amino-acid oxidase OS=Pseudechis australis PE=1 SV=1 26 476 6.0E-18
sp|P86810|OXLA_SIGCA L-amino-acid oxidase OS=Siganus canaliculatus PE=1 SV=2 14 476 1.0E-17
sp|Q6TGQ9|OXLA_BOTJR L-amino-acid oxidase (Fragment) OS=Bothrops jararacussu PE=1 SV=1 26 469 1.0E-17
sp|Q6WP39|OXLA_TRIST L-amino-acid oxidase OS=Trimeresurus stejnegeri PE=1 SV=1 26 484 2.0E-17
sp|Q6TGQ8|OXLA_BOTMO L-amino-acid oxidase (Fragment) OS=Bothrops moojeni PE=1 SV=1 26 467 3.0E-17
sp|G8XQX1|OXLA_DABRR L-amino-acid oxidase OS=Daboia russelii PE=1 SV=1 26 476 6.0E-17
sp|Q4JHE2|OXLA_NOTSC L-amino-acid oxidase OS=Notechis scutatus scutatus PE=2 SV=1 26 484 3.0E-16
sp|P81382|OXLA_CALRH L-amino-acid oxidase OS=Calloselasma rhodostoma PE=1 SV=2 26 476 2.0E-15
sp|A8QL58|OXLA_NAJAT L-amino-acid oxidase (Fragment) OS=Naja atra PE=1 SV=1 26 427 6.0E-15
sp|Q8H191|PAO4_ARATH Probable polyamine oxidase 4 OS=Arabidopsis thaliana GN=PAO4 PE=1 SV=1 26 476 1.0E-13
sp|O09046|OXLA_MOUSE L-amino-acid oxidase OS=Mus musculus GN=Il4i1 PE=1 SV=1 42 473 9.0E-13
sp|Q4F867|OXLA_DABSI L-amino-acid oxidase (Fragments) OS=Daboia siamensis PE=1 SV=2 207 476 2.0E-11
sp|P81383|OXLA_OPHHA L-amino-acid oxidase OS=Ophiophagus hannah PE=1 SV=3 26 473 2.0E-11
sp|Q9Y802|LSD1_SCHPO Lysine-specific histone demethylase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsd1 PE=1 SV=1 20 477 8.0E-09
sp|O18851|AOFA_SHEEP Amine oxidase [flavin-containing] A (Fragment) OS=Ovis aries GN=MAOA PE=3 SV=1 288 332 2.0E-07
sp|O64411|PAO_MAIZE Polyamine oxidase OS=Zea mays GN=PAO PE=1 SV=1 259 483 5.0E-06
sp|Q6Z690|LDL1_ORYSJ Lysine-specific histone demethylase 1 homolog 1 OS=Oryza sativa subsp. japonica GN=Os02g0755200 PE=2 SV=1 233 477 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7748
MKASTKIAAITSTLTTGIGALQHVDVAVVGGGLSGLSTAQDLAAAGKSFVVLEARGRVGGRVLNAEVGSVGVEEV
GAEFVGPTQDHVLALAASLGLTTYQTWEEGNITLYRNGSLTRYALDSSSDGFPPMDPVASAQVKSVAEEFDQMAG
QLPISVPWEHPSASQWDSQTCESFVRARVNHSDALFTLDTIFDAVLSTSTSEPSLLYWLAYISSAGNSTVPGSMS
RLLSTAGGAQDSRIDGGTALLATKLAERVGLDNIRLNAPVHKISRQKDLYSIYWNDQSVTADYVVLALPPPLASR
IFYDPPLPAGRDQLTQRMPMSSIGKAILIYPQPWWRERGLNGQVLSDSGVIRATFDNTPREANFGALMGFIGGNQ
MRDLDQLDEDRIKDLVVADFVRFFGPAAANATSFVLQRWDLDPFSRGGPVAFAPPSVLSEYGPFLRRPFENMHFA
GTETADYWVGYMDGALRSGERAAREVLDKMSKSP*
Coding >Hirsu2|7748
ATGAAGGCGAGCACGAAGATTGCGGCAATCACTTCCACCCTCACGACCGGGATCGGCGCGCTGCAGCATGTAGAC
GTCGCCGTTGTCGGGGGGGGCCTCAGCGGCCTGTCCACCGCCCAGGATCTCGCGGCAGCCGGCAAGTCTTTTGTT
GTTCTGGAGGCCCGCGGACGCGTCGGCGGCAGAGTCTTGAACGCCGAAGTCGGCAGCGTGGGCGTGGAGGAGGTG
GGTGCCGAATTCGTCGGGCCTACTCAAGACCATGTCCTCGCCCTCGCCGCCTCACTGGGGCTGACGACATACCAA
ACCTGGGAAGAAGGAAACATCACATTATACCGGAACGGCTCACTTACTCGGTATGCCTTGGATTCTTCCTCCGAT
GGCTTCCCGCCGATGGATCCCGTGGCTTCGGCCCAGGTAAAGTCTGTCGCCGAGGAATTTGATCAAATGGCCGGG
CAACTCCCGATCAGTGTGCCGTGGGAACATCCGTCTGCCTCTCAATGGGACAGCCAAACGTGCGAAAGCTTCGTG
CGGGCCCGGGTCAATCACTCCGATGCTCTGTTCACCCTCGACACCATTTTCGATGCGGTCCTCTCAACCTCGACC
AGCGAACCGTCCTTACTCTACTGGCTTGCCTACATCTCCAGCGCAGGAAACTCTACCGTGCCGGGCTCCATGAGT
CGGCTGCTGTCGACCGCGGGCGGAGCGCAGGACAGCCGCATCGACGGCGGCACCGCCCTTCTGGCGACGAAGCTA
GCGGAGCGCGTCGGCCTAGACAATATCCGCTTGAACGCACCCGTTCACAAGATCAGTCGGCAGAAGGACCTCTAC
TCCATCTACTGGAATGACCAAAGCGTAACGGCCGACTACGTGGTGCTTGCTTTGCCGCCCCCGCTGGCCAGCCGC
ATCTTCTACGACCCCCCATTGCCGGCCGGGCGAGACCAGCTCACGCAGCGCATGCCGATGAGCTCCATCGGCAAA
GCCATTCTCATCTACCCACAGCCCTGGTGGCGTGAGCGCGGCCTCAACGGCCAGGTCCTCAGCGACAGCGGTGTC
ATCCGCGCCACCTTTGACAACACGCCGCGCGAGGCCAACTTCGGCGCCCTCATGGGCTTCATCGGCGGCAACCAG
ATGCGGGACCTCGATCAGCTCGACGAGGACAGGATCAAGGACCTCGTCGTCGCCGACTTCGTCCGGTTCTTCGGC
CCCGCGGCAGCCAACGCGACTAGTTTCGTGCTGCAGCGATGGGACCTGGACCCCTTCTCCCGCGGGGGGCCCGTC
GCCTTTGCTCCGCCCAGCGTCCTGAGCGAATACGGCCCGTTCCTGAGGAGGCCGTTTGAAAACATGCACTTCGCC
GGGACCGAGACGGCGGATTACTGGGTCGGCTACATGGACGGAGCTCTAAGGTCGGGCGAACGTGCAGCGCGGGAG
GTCCTCGACAAGATGTCAAAGTCACCTTGA
Transcript >Hirsu2|7748
ATGAAGGCGAGCACGAAGATTGCGGCAATCACTTCCACCCTCACGACCGGGATCGGCGCGCTGCAGCATGTAGAC
GTCGCCGTTGTCGGGGGGGGCCTCAGCGGCCTGTCCACCGCCCAGGATCTCGCGGCAGCCGGCAAGTCTTTTGTT
GTTCTGGAGGCCCGCGGACGCGTCGGCGGCAGAGTCTTGAACGCCGAAGTCGGCAGCGTGGGCGTGGAGGAGGTG
GGTGCCGAATTCGTCGGGCCTACTCAAGACCATGTCCTCGCCCTCGCCGCCTCACTGGGGCTGACGACATACCAA
ACCTGGGAAGAAGGAAACATCACATTATACCGGAACGGCTCACTTACTCGGTATGCCTTGGATTCTTCCTCCGAT
GGCTTCCCGCCGATGGATCCCGTGGCTTCGGCCCAGGTAAAGTCTGTCGCCGAGGAATTTGATCAAATGGCCGGG
CAACTCCCGATCAGTGTGCCGTGGGAACATCCGTCTGCCTCTCAATGGGACAGCCAAACGTGCGAAAGCTTCGTG
CGGGCCCGGGTCAATCACTCCGATGCTCTGTTCACCCTCGACACCATTTTCGATGCGGTCCTCTCAACCTCGACC
AGCGAACCGTCCTTACTCTACTGGCTTGCCTACATCTCCAGCGCAGGAAACTCTACCGTGCCGGGCTCCATGAGT
CGGCTGCTGTCGACCGCGGGCGGAGCGCAGGACAGCCGCATCGACGGCGGCACCGCCCTTCTGGCGACGAAGCTA
GCGGAGCGCGTCGGCCTAGACAATATCCGCTTGAACGCACCCGTTCACAAGATCAGTCGGCAGAAGGACCTCTAC
TCCATCTACTGGAATGACCAAAGCGTAACGGCCGACTACGTGGTGCTTGCTTTGCCGCCCCCGCTGGCCAGCCGC
ATCTTCTACGACCCCCCATTGCCGGCCGGGCGAGACCAGCTCACGCAGCGCATGCCGATGAGCTCCATCGGCAAA
GCCATTCTCATCTACCCACAGCCCTGGTGGCGTGAGCGCGGCCTCAACGGCCAGGTCCTCAGCGACAGCGGTGTC
ATCCGCGCCACCTTTGACAACACGCCGCGCGAGGCCAACTTCGGCGCCCTCATGGGCTTCATCGGCGGCAACCAG
ATGCGGGACCTCGATCAGCTCGACGAGGACAGGATCAAGGACCTCGTCGTCGCCGACTTCGTCCGGTTCTTCGGC
CCCGCGGCAGCCAACGCGACTAGTTTCGTGCTGCAGCGATGGGACCTGGACCCCTTCTCCCGCGGGGGGCCCGTC
GCCTTTGCTCCGCCCAGCGTCCTGAGCGAATACGGCCCGTTCCTGAGGAGGCCGTTTGAAAACATGCACTTCGCC
GGGACCGAGACGGCGGATTACTGGGTCGGCTACATGGACGGAGCTCTAAGGTCGGGCGAACGTGCAGCGCGGGAG
GTCCTCGACAAGATGTCAAAGTCACCTTGA
Gene >Hirsu2|7748
ATGAAGGCGAGCACGAAGATTGCGGCAATCACTTCCACCCTCACGACCGGGATCGGCGCGCTGCAGCATGTAGAC
GTCGCCGTTGTCGGGGGGGGCCTCAGCGGCCTGTCCACCGCCCAGGATCTCGCGGCAGCCGGCAAGTCTTTTGTT
GTTCTGGAGGCCCGCGGACGCGTCGGCGGCAGAGTCTTGAACGCCGAAGTCGGCAGCGTGGGCGTGGAGGAGGTG
GGTGCCGAATTCGTCGGGCCTACTCAAGACCATGTCCTCGCCCTCGCCGCCTCACTGGGGCTGACGACATACCAA
ACCTGGGAAGAAGGAAACATCACATTATACCGGAACGGCTCACTTACTCGGTATGCCTTGGATTCTTCCTCCGAT
GGCTTCCCGCCGATGGATCCCGTGGCTTCGGCCCAGGTAAAGTCTGTCGCCGAGGAATTTGATCAAATGGCCGGG
CAACTCCCGATCAGTGTGCCGTGGGAACATCCGTCTGCCTCTCAATGGGACAGCCAAACGTGCGAAAGCTTCGTG
CGGGCCCGGGTCAATCACTCCGATGCTCTGTTCACCCTCGACACCATTTTCGATGCGGTCCTCTCAACCTCGACC
AGCGAACCGTCCTTACTCTACTGGCTTGCCTACATCTCCAGCGCAGGAAACTCTACCGTGCCGGGCTCCATGAGT
CGGCTGCTGTCGACCGCGGGCGGAGCGCAGGACAGCCGCATCGACGGCGGCACCGCCCTTCTGGCGACGAAGCTA
GCGGAGCGCGTCGGCCTAGACAATATCCGCTTGAACGCACCCGTTCACAAGATCAGTCGGCAGAAGGACCTCTAC
TCCATCTACTGGAATGACCAAAGCGTAACGGCCGACTACGTGGTGCTTGCTTTGCCGCCCCCGCTGGCCAGCCGC
ATCTTCTACGACCCCCCATTGCCGGCCGGGCGAGACCAGCTCACGCAGCGCATGCCGATGAGCTCCATCGGCAAA
GCCATTCTCATCTACCCACAGCCCTGGTGGCGTGAGCGCGGCCTCAACGGCCAGGTCCTCAGCGACAGCGGTGTC
ATCCGCGCCACCTTTGACAACACGCCGCGCGAGGCCAACTTCGGCGCCCTCATGGGCTTCATCGGCGGCAACCAG
ATGCGGGACCTCGATCAGCTCGACGAGGACAGGATCAAGGACCTCGTCGTCGCCGACTTCGTCCGGTTCTTCGGC
CCCGCGGCAGCCAACGCGACTAGTTTCGTGCTGCAGCGATGGGACCTGGACCCCTTCTCCCGCGGGGGGCCCGTC
GCCTTTGCTCCGCCCAGCGTCCTGAGCGAATACGGCCCGTTCCTGAGGAGGCCGTTTGAAAACATGCACTTCGCC
GGGACCGAGACGGCGGATTACTGGGTCGGCTACATGGACGGAGCTCTAAGGTCGGGCGAACGTGCAGCGCGGGAG
GTCCTCGACAAGATGTCAAAGTCACCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail