Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7747
Gene name
LocationContig_47:14478..14943
Strand-
Gene length (bp)465
Transcript length (bp)465
Coding sequence length (bp)465
Protein length (aa) 155

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 1.9E-16 31 133
PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain 1.1E-14 47 141
PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain 4.4E-12 57 135
PF08445 FR47 FR47-like protein 4.1E-05 77 138

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016747 transferase activity, transferring acyl groups other than amino-acyl groups Yes
GO:0016746 transferase activity, transferring acyl groups No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7747
MGTALHPATAQDVPAVRDLVKAAFSKYVERIGKPPAPMLVDYDDLLKTQSLFVLRGGDDGRLVGTIVLEMDKDSK
LVHIGNLAVDPAAQGRGFGRALLEHAERVALANNMTTLALYTNVKMHENFGLYAKMGFREVERRTELSYERVYFR
KDLP*
Coding >Hirsu2|7747
ATGGGCACTGCACTCCATCCAGCCACTGCCCAAGACGTGCCCGCCGTCAGGGATCTTGTCAAGGCGGCATTTTCG
AAATACGTTGAGCGGATCGGCAAGCCTCCCGCACCCATGTTAGTAGACTATGACGACCTTCTCAAGACCCAAAGC
CTGTTCGTGCTCCGAGGCGGCGACGACGGGAGACTAGTCGGGACCATTGTCCTGGAGATGGATAAGGATTCAAAG
CTCGTTCACATCGGAAACCTAGCAGTGGATCCAGCCGCCCAGGGTCGCGGATTTGGGCGGGCTCTACTCGAGCAC
GCTGAGAGAGTGGCATTGGCCAACAACATGACAACTCTCGCCCTCTACACCAATGTGAAGATGCACGAGAACTTT
GGTCTTTACGCAAAGATGGGCTTCAGGGAGGTTGAAAGAAGGACGGAGCTGAGCTATGAACGGGTTTATTTTCGG
AAGGATCTTCCGTAG
Transcript >Hirsu2|7747
ATGGGCACTGCACTCCATCCAGCCACTGCCCAAGACGTGCCCGCCGTCAGGGATCTTGTCAAGGCGGCATTTTCG
AAATACGTTGAGCGGATCGGCAAGCCTCCCGCACCCATGTTAGTAGACTATGACGACCTTCTCAAGACCCAAAGC
CTGTTCGTGCTCCGAGGCGGCGACGACGGGAGACTAGTCGGGACCATTGTCCTGGAGATGGATAAGGATTCAAAG
CTCGTTCACATCGGAAACCTAGCAGTGGATCCAGCCGCCCAGGGTCGCGGATTTGGGCGGGCTCTACTCGAGCAC
GCTGAGAGAGTGGCATTGGCCAACAACATGACAACTCTCGCCCTCTACACCAATGTGAAGATGCACGAGAACTTT
GGTCTTTACGCAAAGATGGGCTTCAGGGAGGTTGAAAGAAGGACGGAGCTGAGCTATGAACGGGTTTATTTTCGG
AAGGATCTTCCGTAG
Gene >Hirsu2|7747
ATGGGCACTGCACTCCATCCAGCCACTGCCCAAGACGTGCCCGCCGTCAGGGATCTTGTCAAGGCGGCATTTTCG
AAATACGTTGAGCGGATCGGCAAGCCTCCCGCACCCATGTTAGTAGACTATGACGACCTTCTCAAGACCCAAAGC
CTGTTCGTGCTCCGAGGCGGCGACGACGGGAGACTAGTCGGGACCATTGTCCTGGAGATGGATAAGGATTCAAAG
CTCGTTCACATCGGAAACCTAGCAGTGGATCCAGCCGCCCAGGGTCGCGGATTTGGGCGGGCTCTACTCGAGCAC
GCTGAGAGAGTGGCATTGGCCAACAACATGACAACTCTCGCCCTCTACACCAATGTGAAGATGCACGAGAACTTT
GGTCTTTACGCAAAGATGGGCTTCAGGGAGGTTGAAAGAAGGACGGAGCTGAGCTATGAACGGGTTTATTTTCGG
AAGGATCTTCCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail