Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7741
Gene name
LocationContig_469:17856..18722
Strand+
Gene length (bp)866
Transcript length (bp)813
Coding sequence length (bp)813
Protein length (aa) 271

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5521 0.6485 0.3713 0.0343 0.1896 0.023 0.1534 0.1204 0.214 0.101

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup58
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4910
Ophiocordyceps camponoti-floridani Ophcf2|06958
Ophiocordyceps camponoti-rufipedis Ophun1|4560
Ophiocordyceps camponoti-rufipedis Ophun1|3608
Ophiocordyceps camponoti-rufipedis Ophun1|3607
Ophiocordyceps camponoti-rufipedis Ophun1|3606
Ophiocordyceps camponoti-rufipedis Ophun1|1918
Ophiocordyceps camponoti-rufipedis Ophun1|4301
Ophiocordyceps kimflemingae Ophio5|7704
Ophiocordyceps subramaniannii Hirsu2|299
Ophiocordyceps subramaniannii Hirsu2|8307
Ophiocordyceps subramaniannii Hirsu2|8186
Ophiocordyceps subramaniannii Hirsu2|7741 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7709
Ophiocordyceps subramaniannii Hirsu2|5174
Ophiocordyceps subramaniannii Hirsu2|4474
Ophiocordyceps subramaniannii Hirsu2|3083
Ophiocordyceps subramaniannii Hirsu2|86
Ophiocordyceps subramaniannii Hirsu2|8924

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7741
MAALSEDDRDIIARHPFDSSLDYLKKSLQDAEESYVSASCSHDDTVNSCADNRQKAISRLLSAFQGAEAALIIRS
AISSRNVAADLALLFARVQNGDFTYSYYRPLVEGVLQKASDIEIWSAVLDLIATLTRVTPPESIPTKFDSTPITH
SSASQQGAEQTRELVERKVFEEIRFCTYREVNGFFEKYFEGKDWTRRALDVYETTKALHVDGAWTDLPDPPVQAE
VLDWWFRFQDDFLSEERRGYYSTTNPNDLIDPRRGARLEGCRSHR*
Coding >Hirsu2|7741
ATGGCTGCTCTATCAGAAGACGACCGCGACATAATCGCGCGCCACCCCTTCGACAGCTCCCTGGACTATCTAAAG
AAGTCACTTCAGGATGCAGAGGAGTCCTATGTTTCAGCCTCCTGTTCGCATGATGACACTGTCAACAGCTGTGCA
GATAATCGTCAAAAGGCAATATCCCGTCTCCTATCTGCTTTTCAGGGAGCTGAAGCAGCACTCATTATCCGATCA
GCAATCAGCAGTCGAAATGTGGCTGCTGACTTGGCCCTTTTGTTCGCACGCGTTCAAAATGGAGACTTCACCTAC
AGCTACTACCGCCCGCTTGTGGAAGGTGTCCTTCAAAAGGCGTCCGACATCGAGATCTGGAGCGCCGTACTTGAT
CTCATCGCCACGCTTACCCGAGTGACGCCTCCTGAAAGCATCCCGACCAAATTCGACAGCACGCCGATCACCCAT
TCCTCTGCTTCCCAGCAAGGTGCCGAACAGACACGCGAGTTGGTGGAAAGAAAGGTCTTCGAGGAGATCAGATTC
TGCACATATCGCGAGGTGAACGGGTTCTTTGAGAAATACTTTGAGGGGAAAGACTGGACGCGCCGTGCCTTGGAC
GTTTATGAGACGACGAAGGCTCTGCACGTTGATGGCGCCTGGACCGATCTTCCTGACCCGCCCGTGCAGGCCGAA
GTTCTTGACTGGTGGTTCCGATTCCAGGATGACTTCCTCTCGGAGGAGCGACGCGGCTATTACTCAACCACGAAC
CCAAACGACCTTATCGACCCCAGGCGCGGCGCACGACTGGAAGGATGTCGAAGTCATCGGTGA
Transcript >Hirsu2|7741
ATGGCTGCTCTATCAGAAGACGACCGCGACATAATCGCGCGCCACCCCTTCGACAGCTCCCTGGACTATCTAAAG
AAGTCACTTCAGGATGCAGAGGAGTCCTATGTTTCAGCCTCCTGTTCGCATGATGACACTGTCAACAGCTGTGCA
GATAATCGTCAAAAGGCAATATCCCGTCTCCTATCTGCTTTTCAGGGAGCTGAAGCAGCACTCATTATCCGATCA
GCAATCAGCAGTCGAAATGTGGCTGCTGACTTGGCCCTTTTGTTCGCACGCGTTCAAAATGGAGACTTCACCTAC
AGCTACTACCGCCCGCTTGTGGAAGGTGTCCTTCAAAAGGCGTCCGACATCGAGATCTGGAGCGCCGTACTTGAT
CTCATCGCCACGCTTACCCGAGTGACGCCTCCTGAAAGCATCCCGACCAAATTCGACAGCACGCCGATCACCCAT
TCCTCTGCTTCCCAGCAAGGTGCCGAACAGACACGCGAGTTGGTGGAAAGAAAGGTCTTCGAGGAGATCAGATTC
TGCACATATCGCGAGGTGAACGGGTTCTTTGAGAAATACTTTGAGGGGAAAGACTGGACGCGCCGTGCCTTGGAC
GTTTATGAGACGACGAAGGCTCTGCACGTTGATGGCGCCTGGACCGATCTTCCTGACCCGCCCGTGCAGGCCGAA
GTTCTTGACTGGTGGTTCCGATTCCAGGATGACTTCCTCTCGGAGGAGCGACGCGGCTATTACTCAACCACGAAC
CCAAACGACCTTATCGACCCCAGGCGCGGCGCACGACTGGAAGGATGTCGAAGTCATCGGTGA
Gene >Hirsu2|7741
ATGGCTGCTCTATCAGAAGACGACCGCGACATAATCGCGCGCCACCCCTTCGACAGCTCCCTGGACTATCTAAAG
AAGTCACTTCAGGATGCAGAGGAGTCCTATGTTTCAGCCTCCTGTTCGCATGATGACACTGTCAACAGCTGTGCA
GATAATCGTCAAAAGGCAATATCCCGTCTCCTATCTGCTTTTCAGGGAGCTGAAGCAGCACTCATTATCCGATCA
GCAATCAGCAGTCGAAATGTGGCTGCTGACTTGGCCCTTTTGTTCGCACGCGTTCAAAATGGAGACTTCACCTAC
AGCTACTACCGCCCGCTTGTGGAAGGTGTCCTTCAAAAGGCGTCCGACATCGAGATCTGGAGCGCCGTACTTGAT
CTCATCGCCACGCTTACCCGAGTGACGCCTCCTGAAAGCATCCCGACCAAATTCGACAGCACGCCGATCACCCAT
TCCTCTGCTTCCCAGCAAGGTGCCGAACAGACACGCGAGTTGGTGGAAAGAAAGGTCTTCGAGGAGATCAGATTC
TGCACATATCGCGAGGTGAACGGGTTCTTTGAGAAATACTTTGAGGGGAAAGACTGGACGCGCCGTGCCTTGGAC
GTTTATGAGACGACGAAGGCTCTGCACGTTGATGGCGCCTGGACCGATCTTCCTGACCCGCCCGTGCAGGCCGAA
GTTCTTGACTGGTGGTTCCGATTCCAGGATGACTTCCTCTCGGAGGAGCGACGCGGCTATTACTCAACCACGAAC
CCAAACGACCTTATCGGTGCCGAAGCTCAGCGGCAAATCGATCTCTTTGTAAAGCGAAAGAATGAGCAGACCCCA
GGCGCGGCGCACGACTGGAAGGATGTCGAAGTCATCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail