Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7736
Gene name
LocationContig_469:6377..8141
Strand+
Gene length (bp)1764
Transcript length (bp)1764
Coding sequence length (bp)1764
Protein length (aa) 588

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14529 Exo_endo_phos_2 Endonuclease-reverse transcriptase 1.9E-19 170 296

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q03277|PO11_BRACO Retrovirus-related Pol polyprotein from type-1 retrotransposable element R1 (Fragment) OS=Bradysia coprophila PE=3 SV=1 251 570 4.0E-11
sp|P21328|RTJK_DROME RNA-directed DNA polymerase from mobile element jockey OS=Drosophila melanogaster GN=pol PE=1 SV=1 290 570 8.0E-09
sp|P16425|Y2R2_DROME Putative 115 kDa protein in type-1 retrotransposable element R1DM OS=Drosophila melanogaster GN=R1A1-elementORF2 PE=3 SV=1 291 575 3.0E-08
sp|P21329|RTJK_DROFU RNA-directed DNA polymerase from mobile element jockey OS=Drosophila funebris GN=jockeypol PE=1 SV=1 387 571 6.0E-06

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5772 0.5118 0.524 0.1355 0.1531 0.1926 0.1018 0.1116 0.1642 0.0724

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup369
Change Orthofinder run
Species Protein ID
Ophiocordyceps kimflemingae Ophio5|941
Ophiocordyceps subramaniannii Hirsu2|10220
Ophiocordyceps subramaniannii Hirsu2|1656
Ophiocordyceps subramaniannii Hirsu2|552
Ophiocordyceps subramaniannii Hirsu2|7707
Ophiocordyceps subramaniannii Hirsu2|7736 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8187
Ophiocordyceps subramaniannii Hirsu2|84
Ophiocordyceps subramaniannii Hirsu2|8425
Ophiocordyceps subramaniannii Hirsu2|8428

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7736
MLQTVKTWAIKPSGAASLRCAEGVPVRVITTGSAMQWSLDASCAADRTSRSAGTAVCETSTPMHKTLSILQLNVR
KRDPVQQSLMNDEDLKDYGVLAVSEPYARMIDGKVVTSPMMHSNWTKIVPTHMNDGLWPIRSMLWVRHDVEAVQI
PIPSADLTAAVLRLPERSVLVVSVYVEGKGTEALKSTTGLLHDLIQGFRQGSGARTDVVLAGDFNSHDLLLGGDD
ISVQRQGEAGPIIDLMNDHGLRSLLPRDTKTWQGKDQESTIDLVLTTSELADEVTTCAIHPTDHGSDHRAIQTTF
DITMVERSATPRFLFKNAPWNLIRSRVKDNLRLLPWAVDVQTQTDQLMRVVLGAIHELTPRARPSPYAKRWWTQD
LTQLRRTHTFWRNQARMQRRAGQARPDLEQRAKEAAKEFHDAIRHQRRAHWDDFLSDDANIWKATKYLKVGKSTT
GDKVPPLRKGGGSTTEDKADQADDLLRAFFPPLPATIEDEGMRPQRIAVPMPELTLGEIEEKVMTAKPWKAPGGD
ELPTAVWRQLWPVSRDRIFALFDASLRDGVVPRQWKNTKIVPLKKPHNDKLISANCNRTYRR*
Coding >Hirsu2|7736
ATGCTTCAAACTGTCAAGACATGGGCCATAAAGCCTTCAGGTGCAGCAAGCCTCAGGTGTGCGGAAGGTGTGCCG
GTGCGGGTCATCACCACAGGGAGTGCCATGCAATGGAGCCTAGATGCGTCTTGTGCAGCGGACCGCACGAGTCGT
TCAGCTGGAACTGCCGTGTGCGAAACATCCACTCCAATGCATAAGACACTAAGCATTTTACAGCTCAATGTGCGA
AAACGGGACCCGGTACAGCAGAGTTTGATGAACGACGAGGACCTCAAGGATTACGGAGTGCTGGCAGTCTCCGAA
CCGTATGCTAGGATGATCGATGGCAAGGTGGTGACGAGCCCCATGATGCACAGCAACTGGACGAAAATAGTGCCA
ACGCACATGAACGACGGCCTCTGGCCGATCCGTAGTATGCTTTGGGTGCGACACGACGTGGAAGCGGTGCAGATT
CCGATACCATCGGCCGATCTCACGGCAGCGGTGCTCCGACTGCCGGAAAGAAGTGTTTTAGTGGTTTCGGTCTAC
GTGGAAGGAAAAGGCACAGAAGCGCTGAAAAGCACGACTGGACTATTGCATGACTTGATCCAAGGATTCCGTCAA
GGCTCTGGTGCACGCACAGATGTGGTGTTGGCTGGAGACTTCAACTCTCATGACCTACTCTTGGGAGGAGACGAT
ATTTCGGTTCAGAGACAGGGAGAAGCGGGGCCGATCATCGATCTGATGAACGACCATGGCCTCAGGAGCCTGCTC
CCGAGGGACACGAAAACGTGGCAAGGCAAGGATCAGGAGAGCACCATCGATCTGGTGCTGACGACGTCAGAGTTG
GCCGACGAAGTGACAACATGCGCCATCCATCCGACCGATCATGGATCAGACCACAGAGCCATTCAGACGACTTTT
GACATCACGATGGTGGAGAGAAGTGCGACGCCCAGATTTTTGTTCAAGAACGCCCCTTGGAATCTCATACGAAGC
CGGGTGAAAGACAATCTGCGACTCTTGCCTTGGGCTGTCGACGTTCAAACCCAGACAGATCAGCTAATGCGGGTC
GTTCTGGGGGCTATCCACGAACTGACGCCTCGGGCACGGCCATCGCCGTATGCAAAACGTTGGTGGACCCAGGAT
CTTACACAACTTCGGCGGACGCACACGTTCTGGCGAAACCAAGCACGGATGCAACGGCGAGCAGGCCAGGCGCGA
CCAGACCTCGAACAGCGGGCCAAAGAAGCAGCGAAGGAGTTCCACGATGCCATTCGACACCAGAGGAGAGCGCAT
TGGGATGACTTCCTCTCCGACGATGCTAACATCTGGAAGGCGACTAAATATCTTAAAGTCGGCAAGAGCACGACG
GGCGACAAGGTGCCACCTTTGAGGAAAGGGGGTGGATCAACGACCGAGGATAAAGCAGACCAGGCAGACGACCTG
CTCAGAGCCTTTTTTCCACCCTTACCCGCGACAATCGAGGATGAGGGGATGCGACCACAGCGAATAGCGGTGCCA
ATGCCCGAACTCACTTTGGGAGAGATCGAGGAAAAGGTCATGACAGCGAAACCGTGGAAAGCACCCGGAGGAGAT
GAACTTCCTACAGCGGTATGGAGACAACTCTGGCCGGTGTCAAGGGATCGGATATTTGCTCTCTTCGATGCATCC
CTCCGAGACGGCGTGGTACCTCGTCAATGGAAAAACACGAAAATCGTCCCACTGAAGAAGCCACACAATGATAAA
TTGATATCAGCAAACTGCAATCGGACGTACAGACGTTAA
Transcript >Hirsu2|7736
ATGCTTCAAACTGTCAAGACATGGGCCATAAAGCCTTCAGGTGCAGCAAGCCTCAGGTGTGCGGAAGGTGTGCCG
GTGCGGGTCATCACCACAGGGAGTGCCATGCAATGGAGCCTAGATGCGTCTTGTGCAGCGGACCGCACGAGTCGT
TCAGCTGGAACTGCCGTGTGCGAAACATCCACTCCAATGCATAAGACACTAAGCATTTTACAGCTCAATGTGCGA
AAACGGGACCCGGTACAGCAGAGTTTGATGAACGACGAGGACCTCAAGGATTACGGAGTGCTGGCAGTCTCCGAA
CCGTATGCTAGGATGATCGATGGCAAGGTGGTGACGAGCCCCATGATGCACAGCAACTGGACGAAAATAGTGCCA
ACGCACATGAACGACGGCCTCTGGCCGATCCGTAGTATGCTTTGGGTGCGACACGACGTGGAAGCGGTGCAGATT
CCGATACCATCGGCCGATCTCACGGCAGCGGTGCTCCGACTGCCGGAAAGAAGTGTTTTAGTGGTTTCGGTCTAC
GTGGAAGGAAAAGGCACAGAAGCGCTGAAAAGCACGACTGGACTATTGCATGACTTGATCCAAGGATTCCGTCAA
GGCTCTGGTGCACGCACAGATGTGGTGTTGGCTGGAGACTTCAACTCTCATGACCTACTCTTGGGAGGAGACGAT
ATTTCGGTTCAGAGACAGGGAGAAGCGGGGCCGATCATCGATCTGATGAACGACCATGGCCTCAGGAGCCTGCTC
CCGAGGGACACGAAAACGTGGCAAGGCAAGGATCAGGAGAGCACCATCGATCTGGTGCTGACGACGTCAGAGTTG
GCCGACGAAGTGACAACATGCGCCATCCATCCGACCGATCATGGATCAGACCACAGAGCCATTCAGACGACTTTT
GACATCACGATGGTGGAGAGAAGTGCGACGCCCAGATTTTTGTTCAAGAACGCCCCTTGGAATCTCATACGAAGC
CGGGTGAAAGACAATCTGCGACTCTTGCCTTGGGCTGTCGACGTTCAAACCCAGACAGATCAGCTAATGCGGGTC
GTTCTGGGGGCTATCCACGAACTGACGCCTCGGGCACGGCCATCGCCGTATGCAAAACGTTGGTGGACCCAGGAT
CTTACACAACTTCGGCGGACGCACACGTTCTGGCGAAACCAAGCACGGATGCAACGGCGAGCAGGCCAGGCGCGA
CCAGACCTCGAACAGCGGGCCAAAGAAGCAGCGAAGGAGTTCCACGATGCCATTCGACACCAGAGGAGAGCGCAT
TGGGATGACTTCCTCTCCGACGATGCTAACATCTGGAAGGCGACTAAATATCTTAAAGTCGGCAAGAGCACGACG
GGCGACAAGGTGCCACCTTTGAGGAAAGGGGGTGGATCAACGACCGAGGATAAAGCAGACCAGGCAGACGACCTG
CTCAGAGCCTTTTTTCCACCCTTACCCGCGACAATCGAGGATGAGGGGATGCGACCACAGCGAATAGCGGTGCCA
ATGCCCGAACTCACTTTGGGAGAGATCGAGGAAAAGGTCATGACAGCGAAACCGTGGAAAGCACCCGGAGGAGAT
GAACTTCCTACAGCGGTATGGAGACAACTCTGGCCGGTGTCAAGGGATCGGATATTTGCTCTCTTCGATGCATCC
CTCCGAGACGGCGTGGTACCTCGTCAATGGAAAAACACGAAAATCGTCCCACTGAAGAAGCCACACAATGATAAA
TTGATATCAGCAAACTGCAATCGGACGTACAGACGTTAA
Gene >Hirsu2|7736
ATGCTTCAAACTGTCAAGACATGGGCCATAAAGCCTTCAGGTGCAGCAAGCCTCAGGTGTGCGGAAGGTGTGCCG
GTGCGGGTCATCACCACAGGGAGTGCCATGCAATGGAGCCTAGATGCGTCTTGTGCAGCGGACCGCACGAGTCGT
TCAGCTGGAACTGCCGTGTGCGAAACATCCACTCCAATGCATAAGACACTAAGCATTTTACAGCTCAATGTGCGA
AAACGGGACCCGGTACAGCAGAGTTTGATGAACGACGAGGACCTCAAGGATTACGGAGTGCTGGCAGTCTCCGAA
CCGTATGCTAGGATGATCGATGGCAAGGTGGTGACGAGCCCCATGATGCACAGCAACTGGACGAAAATAGTGCCA
ACGCACATGAACGACGGCCTCTGGCCGATCCGTAGTATGCTTTGGGTGCGACACGACGTGGAAGCGGTGCAGATT
CCGATACCATCGGCCGATCTCACGGCAGCGGTGCTCCGACTGCCGGAAAGAAGTGTTTTAGTGGTTTCGGTCTAC
GTGGAAGGAAAAGGCACAGAAGCGCTGAAAAGCACGACTGGACTATTGCATGACTTGATCCAAGGATTCCGTCAA
GGCTCTGGTGCACGCACAGATGTGGTGTTGGCTGGAGACTTCAACTCTCATGACCTACTCTTGGGAGGAGACGAT
ATTTCGGTTCAGAGACAGGGAGAAGCGGGGCCGATCATCGATCTGATGAACGACCATGGCCTCAGGAGCCTGCTC
CCGAGGGACACGAAAACGTGGCAAGGCAAGGATCAGGAGAGCACCATCGATCTGGTGCTGACGACGTCAGAGTTG
GCCGACGAAGTGACAACATGCGCCATCCATCCGACCGATCATGGATCAGACCACAGAGCCATTCAGACGACTTTT
GACATCACGATGGTGGAGAGAAGTGCGACGCCCAGATTTTTGTTCAAGAACGCCCCTTGGAATCTCATACGAAGC
CGGGTGAAAGACAATCTGCGACTCTTGCCTTGGGCTGTCGACGTTCAAACCCAGACAGATCAGCTAATGCGGGTC
GTTCTGGGGGCTATCCACGAACTGACGCCTCGGGCACGGCCATCGCCGTATGCAAAACGTTGGTGGACCCAGGAT
CTTACACAACTTCGGCGGACGCACACGTTCTGGCGAAACCAAGCACGGATGCAACGGCGAGCAGGCCAGGCGCGA
CCAGACCTCGAACAGCGGGCCAAAGAAGCAGCGAAGGAGTTCCACGATGCCATTCGACACCAGAGGAGAGCGCAT
TGGGATGACTTCCTCTCCGACGATGCTAACATCTGGAAGGCGACTAAATATCTTAAAGTCGGCAAGAGCACGACG
GGCGACAAGGTGCCACCTTTGAGGAAAGGGGGTGGATCAACGACCGAGGATAAAGCAGACCAGGCAGACGACCTG
CTCAGAGCCTTTTTTCCACCCTTACCCGCGACAATCGAGGATGAGGGGATGCGACCACAGCGAATAGCGGTGCCA
ATGCCCGAACTCACTTTGGGAGAGATCGAGGAAAAGGTCATGACAGCGAAACCGTGGAAAGCACCCGGAGGAGAT
GAACTTCCTACAGCGGTATGGAGACAACTCTGGCCGGTGTCAAGGGATCGGATATTTGCTCTCTTCGATGCATCC
CTCCGAGACGGCGTGGTACCTCGTCAATGGAAAAACACGAAAATCGTCCCACTGAAGAAGCCACACAATGATAAA
TTGATATCAGCAAACTGCAATCGGACGTACAGACGTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail