Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7724
Gene name
LocationContig_466:11569..14713
Strand+
Gene length (bp)3144
Transcript length (bp)3009
Coding sequence length (bp)3009
Protein length (aa) 1003

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08659 KR KR domain 3.1E-50 661 837
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 5.5E-16 503 637
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 2.4E-12 464 583

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 874 7.0E-92
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 283 877 2.0E-69
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 283 877 2.0E-69
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 372 874 8.0E-53
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 394 874 2.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 874 7.0E-92
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 283 877 2.0E-69
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 283 877 2.0E-69
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 372 874 8.0E-53
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 394 874 2.0E-52
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 428 878 4.0E-51
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 285 873 4.0E-51
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 419 874 8.0E-50
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 375 856 2.0E-49
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 359 840 2.0E-48
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 359 878 3.0E-48
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 359 878 4.0E-48
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 184 834 4.0E-48
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 359 857 6.0E-48
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 244 878 1.0E-47
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 370 972 1.0E-47
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 184 842 6.0E-46
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 184 842 6.0E-46
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 184 842 6.0E-46
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 184 842 6.0E-46
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 184 842 7.0E-46
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 375 981 1.0E-44
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 375 834 5.0E-44
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 359 845 7.0E-44
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 375 856 1.0E-40
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 370 866 3.0E-39
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 375 953 3.0E-38
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 375 866 5.0E-38
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 368 853 2.0E-36
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 359 844 4.0E-36
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 375 953 6.0E-36
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 375 849 1.0E-35
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 375 870 3.0E-35
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 197 845 4.0E-35
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 235 853 5.0E-35
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 359 851 9.0E-35
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 376 982 4.0E-34
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 375 849 6.0E-33
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 359 851 2.0E-32
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 368 877 3.0E-32
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 368 879 4.0E-32
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 375 851 5.0E-32
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 375 857 2.0E-29
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 375 856 3.0E-29
sp|Q8JFV8|VAT1_DANRE Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 376 638 3.0E-27
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 376 637 3.0E-27
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 372 856 2.0E-26
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 368 638 3.0E-25
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 375 873 3.0E-25
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 368 638 5.0E-25
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 376 870 1.0E-24
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 368 638 1.0E-24
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 359 638 3.0E-24
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 376 638 6.0E-24
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 368 638 2.0E-23
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 375 873 4.0E-23
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 368 638 4.0E-23
sp|Q62465|VAT1_MOUSE Synaptic vesicle membrane protein VAT-1 homolog OS=Mus musculus GN=Vat1 PE=1 SV=3 392 637 5.0E-23
sp|Q3MIE4|VAT1_RAT Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus GN=Vat1 PE=1 SV=1 391 637 6.0E-23
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 657 845 3.0E-21
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 662 845 2.0E-20
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 662 845 4.0E-20
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 287 552 1.0E-19
sp|P19333|VAT1_TORCA Synaptic vesicle membrane protein VAT-1 OS=Torpedo californica PE=1 SV=1 374 634 1.0E-19
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 376 574 1.0E-17
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 376 574 5.0E-17
sp|P28304|QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 287 552 8.0E-17
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 679 904 3.0E-16
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 376 574 8.0E-16
sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 376 574 2.0E-14
sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 376 574 2.0E-14
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 376 562 3.0E-14
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 376 627 3.0E-14
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 376 627 4.0E-14
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 638 825 4.0E-14
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 656 825 6.0E-14
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 376 574 6.0E-14
sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 360 641 3.0E-13
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 676 873 8.0E-13
sp|P42865|QOR_LEIAM Probable quinone oxidoreductase OS=Leishmania amazonensis PE=3 SV=1 333 639 1.0E-12
sp|A7RK30|QORL2_NEMVE Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1 323 641 2.0E-12
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 659 877 3.0E-12
sp|B0BNC9|QORL2_RAT Quinone oxidoreductase-like protein 2 OS=Rattus norvegicus PE=2 SV=1 376 639 3.0E-12
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 661 897 6.0E-12
sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 376 574 1.0E-11
sp|Q3UNZ8|QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=1 SV=1 360 639 1.0E-11
sp|Q59I44|CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 376 549 8.0E-11
sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 370 552 9.0E-11
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 651 825 1.0E-10
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 651 825 1.0E-10
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 651 825 1.0E-10
sp|A6QQF5|QORL2_BOVIN Quinone oxidoreductase-like protein 2 OS=Bos taurus PE=2 SV=2 360 639 4.0E-10
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 677 840 9.0E-10
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 677 840 9.0E-10
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 660 824 3.0E-09
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 643 824 4.0E-09
sp|O94564|YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 376 639 8.0E-09
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 677 834 3.0E-08
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 677 834 3.0E-08
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 677 834 3.0E-08
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 660 825 1.0E-07
sp|Q8BGC4|ZADH2_MOUSE Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Mus musculus GN=Zadh2 PE=1 SV=1 371 641 2.0E-07
sp|Q9Z311|MECR_RAT Trans-2-enoyl-CoA reductase, mitochondrial OS=Rattus norvegicus GN=Mecr PE=1 SV=1 353 496 2.0E-07
sp|Q9BV79|MECR_HUMAN Trans-2-enoyl-CoA reductase, mitochondrial OS=Homo sapiens GN=MECR PE=1 SV=2 376 477 1.0E-06
sp|Q9DCS3|MECR_MOUSE Trans-2-enoyl-CoA reductase, mitochondrial OS=Mus musculus GN=Mecr PE=1 SV=2 353 496 1.0E-06
sp|Q7T3C7|RT4I1_DANRE Reticulon-4-interacting protein 1 homolog, mitochondrial OS=Danio rerio GN=rtn4ip1 PE=2 SV=2 375 642 2.0E-06
sp|Q8N4Q0|ZADH2_HUMAN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Homo sapiens GN=ZADH2 PE=1 SV=1 371 642 3.0E-06
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 660 824 6.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7102 0.3497 0.0794 0.0578 0.2456 0.0504 0.0687 0.0891 0.1215 0.0416

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|201
Ophiocordyceps australis 1348a (Ghana) OphauG2|7422
Ophiocordyceps australis 1348a (Ghana) OphauG2|7411
Ophiocordyceps australis 1348a (Ghana) OphauG2|6241
Ophiocordyceps australis 1348a (Ghana) OphauG2|4898
Ophiocordyceps australis 1348a (Ghana) OphauG2|4897
Ophiocordyceps australis 1348a (Ghana) OphauG2|2708
Ophiocordyceps australis 1348a (Ghana) OphauG2|2128
Ophiocordyceps australis 1348a (Ghana) OphauG2|1191
Ophiocordyceps australis 1348a (Ghana) OphauG2|1124
Ophiocordyceps australis 1348a (Ghana) OphauG2|7710
Ophiocordyceps australis map64 (Brazil) OphauB2|4459
Ophiocordyceps australis map64 (Brazil) OphauB2|5387
Ophiocordyceps australis map64 (Brazil) OphauB2|476
Ophiocordyceps australis map64 (Brazil) OphauB2|5635
Ophiocordyceps australis map64 (Brazil) OphauB2|3063
Ophiocordyceps australis map64 (Brazil) OphauB2|5406
Ophiocordyceps australis map64 (Brazil) OphauB2|3017
Ophiocordyceps australis map64 (Brazil) OphauB2|712
Ophiocordyceps australis map64 (Brazil) OphauB2|1455
Ophiocordyceps australis map64 (Brazil) OphauB2|1454
Ophiocordyceps australis map64 (Brazil) OphauB2|6068
Ophiocordyceps australis map64 (Brazil) OphauB2|6715
Ophiocordyceps australis map64 (Brazil) OphauB2|5636
Ophiocordyceps australis map64 (Brazil) OphauB2|7340
Ophiocordyceps australis map64 (Brazil) OphauB2|7710
Ophiocordyceps australis map64 (Brazil) OphauB2|2028
Ophiocordyceps australis map64 (Brazil) OphauB2|5805
Ophiocordyceps camponoti-floridani Ophcf2|02942
Ophiocordyceps subramaniannii Hirsu2|8482
Ophiocordyceps subramaniannii Hirsu2|8480
Ophiocordyceps subramaniannii Hirsu2|7800
Ophiocordyceps subramaniannii Hirsu2|7724 (this protein)
Ophiocordyceps subramaniannii Hirsu2|6729
Ophiocordyceps subramaniannii Hirsu2|5683
Ophiocordyceps subramaniannii Hirsu2|5301
Ophiocordyceps subramaniannii Hirsu2|5151
Ophiocordyceps subramaniannii Hirsu2|4977
Ophiocordyceps subramaniannii Hirsu2|4297
Ophiocordyceps subramaniannii Hirsu2|4296
Ophiocordyceps subramaniannii Hirsu2|3325
Ophiocordyceps subramaniannii Hirsu2|26
Ophiocordyceps subramaniannii Hirsu2|25
Ophiocordyceps subramaniannii Hirsu2|9187
Ophiocordyceps subramaniannii Hirsu2|11188

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7724
MGVLPGWWLGVADGRISEPCPAPERWDTVLKEAGFTGVEAATYDAPPPYHFVQSIVSRPAVPDKSMPAAAGPPAP
RRRLTLLHRSGDGASPNVVRMHAVLGDSGFEVDMFGMHEYQRAMTRDRDIIVALVELETPFFEGMSGLDLAAFQK
LAAGLGVTPVLWVMGPAQAGVGPSGSPGFGLTLGLMRSLRSEQPVAITTLEVDHVDDRAFAAVSSIVERLLLERT
DGAEFSKAASPTDLDREFVLADGVVKVGRYYPVSLSQQDQDPTTKERKPGPLALDIGRTGSLQTLRWVPAPSCEP
AHGEVMVEPRCAGLNFQVGSTPYPSNCFSLSSVRLVSHSRGLFVRETRRTLGSPTDWVQDVLHCMGLLALPDGSF
GTEGSGVVTKVGSGVADLRPGDRVLYMARHCFSTQATMSAQRCVRIGPSLSWENAATMPCAYATAIHCLLDVGDL
RPGQSILIHSACGGVGIAALNVCRSIGGLEVYATAGNAEKVKHLMDVFGLARDRIFSSRDTTFVDGVRAATGGRG
VDLVLNSLSGELLHASWQCVAPYGKMLEISKRDSIGKARLGMDLFEANRSFIGIDVARFDAAKCHRLLQRTVDMF
ECGTIGPIEPVKLFEAADVEAAFRYMQQGTHLGKVVVSIPENGHGLAATLEPPQTELNPQGTYLLVGGLGGLGRV
IATWMVERGARHLLFLSRSAGLSARDQAFFRELECQGCTARAVRGSVTDKAVVERAMASAPPDQPVRGVLQMSMV
VQLVPVANMGLADWEASVRPKAEGTCNLHVAAPKDLDFFLALGSMTGSFGVPCAANYSAGNTYLTAVAQHRRALG
LPASVLHLGFVEDSGYLARSLGVGEMYRLAGSYYLRTQHVLEELNRALTASKPWELERQLTTGVRHTKPLSDPTN
HVLWKRDARMRLYHNERGSCAAATDGEDKDDTLSRVIAAFGMEPSLLDPPASLELGAPKFESALEAFGTDPLLKP
FLEQLIGDFPEARSAAEEAHARERTAA*
Coding >Hirsu2|7724
ATGGGTGTCCTACCCGGATGGTGGCTTGGGGTCGCGGACGGTCGGATCAGCGAGCCGTGCCCGGCACCGGAACGC
TGGGACACGGTGCTCAAGGAGGCCGGCTTCACCGGTGTTGAAGCTGCCACGTACGACGCGCCACCTCCCTACCAT
TTCGTCCAGAGTATTGTCTCGCGGCCGGCCGTCCCCGACAAGAGCATGCCCGCGGCAGCCGGCCCGCCTGCACCT
CGCCGTCGGCTGACTCTGCTTCACCGCTCAGGCGACGGAGCTTCTCCCAACGTTGTGCGGATGCACGCTGTCCTC
GGCGACAGCGGCTTTGAGGTTGACATGTTCGGGATGCACGAGTATCAGCGGGCCATGACCCGCGATCGCGACATC
ATCGTTGCACTGGTCGAGCTCGAGACGCCCTTTTTCGAGGGCATGTCGGGACTAGACCTGGCAGCCTTCCAGAAA
CTCGCTGCGGGCCTGGGCGTCACGCCAGTGCTTTGGGTTATGGGCCCGGCGCAAGCAGGCGTCGGTCCATCGGGC
AGCCCCGGCTTCGGTCTGACTCTGGGGCTGATGCGGTCGCTACGCTCCGAGCAGCCTGTGGCCATTACCACGCTG
GAAGTAGACCACGTCGACGACAGGGCGTTCGCAGCTGTCTCCAGCATTGTGGAGAGGCTTCTGCTGGAGCGCACT
GATGGGGCCGAATTTTCAAAGGCTGCGTCCCCGACGGACCTGGATCGGGAGTTTGTGCTTGCTGATGGGGTCGTC
AAAGTCGGAAGATATTATCCCGTGTCCCTGTCGCAGCAGGATCAGGATCCAACGACGAAAGAACGCAAGCCTGGG
CCCTTGGCTCTCGATATAGGGCGTACGGGCTCGTTGCAGACACTGAGATGGGTGCCTGCCCCTTCTTGTGAGCCG
GCACATGGCGAGGTCATGGTCGAGCCTCGATGCGCAGGTTTGAACTTTCAGGTAGGCAGCACTCCGTACCCCTCC
AACTGCTTCTCTCTGTCATCGGTCCGTCTTGTCTCACATTCTCGCGGACTCTTTGTTCGGGAGACAAGACGGACA
CTGGGATCACCAACTGACTGGGTTCAGGACGTGCTCCACTGCATGGGCCTCCTGGCCTTGCCAGATGGGAGCTTC
GGCACGGAAGGGTCCGGTGTTGTCACCAAGGTAGGGAGCGGTGTCGCAGACCTACGGCCGGGGGACCGAGTCTTG
TACATGGCGCGCCATTGCTTCTCGACTCAAGCTACAATGTCGGCTCAACGATGCGTCAGAATAGGACCGTCGCTG
TCGTGGGAGAACGCAGCGACAATGCCGTGCGCGTACGCCACCGCCATCCATTGTCTGCTGGACGTCGGGGATCTG
CGGCCCGGTCAGTCGATTTTGATTCACTCGGCGTGCGGCGGCGTCGGCATCGCGGCTCTCAACGTGTGCCGGAGC
ATCGGGGGCTTGGAGGTGTACGCCACGGCGGGCAACGCCGAAAAGGTCAAGCACTTGATGGATGTGTTCGGCCTT
GCCCGCGACAGAATCTTTAGCTCCCGCGACACGACCTTTGTCGACGGTGTACGGGCCGCCACTGGTGGGCGTGGC
GTCGACTTGGTCCTTAACAGCCTTTCTGGAGAGCTACTCCACGCATCGTGGCAGTGCGTGGCACCATACGGCAAG
ATGCTGGAGATCAGTAAGAGGGATTCGATTGGCAAGGCGCGGCTGGGCATGGACCTGTTCGAGGCCAACAGAAGC
TTCATCGGTATCGACGTGGCCAGGTTTGATGCGGCGAAATGTCACCGACTGCTCCAGCGCACCGTGGATATGTTC
GAGTGCGGCACTATCGGGCCAATCGAACCCGTCAAGCTGTTTGAGGCGGCAGATGTGGAGGCCGCATTCCGCTAC
ATGCAGCAGGGAACCCACCTCGGCAAGGTTGTCGTGAGCATTCCCGAGAACGGGCACGGTCTCGCCGCGACTCTG
GAGCCACCGCAGACGGAGCTCAACCCCCAAGGCACATACCTTCTCGTGGGCGGCCTGGGCGGCCTGGGTCGCGTC
ATCGCGACGTGGATGGTCGAGAGAGGAGCGCGACATCTTCTCTTCTTGTCGCGGTCGGCGGGCCTCAGCGCGCGC
GACCAGGCCTTCTTCCGCGAGCTGGAGTGCCAGGGCTGCACAGCGCGAGCAGTCAGGGGCAGTGTCACGGACAAG
GCCGTTGTCGAGCGTGCCATGGCCTCGGCGCCCCCGGATCAGCCCGTCAGGGGCGTCCTGCAGATGTCGATGGTG
GTTCAACTCGTACCAGTTGCCAATATGGGCCTGGCGGATTGGGAGGCTTCTGTGAGACCCAAGGCAGAGGGGACG
TGTAATCTTCACGTGGCCGCGCCCAAAGACCTCGACTTCTTCCTCGCGCTTGGGTCTATGACGGGATCCTTTGGT
GTGCCGTGCGCGGCCAACTATTCCGCCGGCAACACGTACCTCACAGCTGTGGCTCAACATCGGCGAGCGCTGGGC
CTGCCGGCGTCGGTCTTGCACCTCGGCTTCGTCGAGGACAGTGGCTACCTTGCTCGCAGCCTGGGGGTCGGCGAG
ATGTACCGACTGGCCGGCAGCTACTACTTACGCACCCAGCACGTACTCGAAGAGCTCAACCGGGCGCTGACTGCC
AGCAAGCCCTGGGAGCTCGAGCGTCAGCTCACGACTGGGGTGCGTCATACAAAGCCACTCTCGGACCCGACCAAC
CATGTGTTGTGGAAGAGGGATGCCCGCATGAGGCTCTACCACAACGAGAGAGGCTCATGCGCCGCTGCGACGGAC
GGTGAAGACAAGGACGATACGCTCTCCCGGGTCATTGCCGCGTTTGGGATGGAGCCAAGCCTCCTCGACCCGCCG
GCTTCGCTGGAGCTCGGAGCGCCCAAGTTCGAGAGCGCGCTCGAAGCCTTCGGCACCGACCCCTTGCTCAAGCCT
TTCTTAGAGCAGTTAATAGGGGATTTCCCCGAGGCGCGGTCGGCAGCGGAGGAGGCGCATGCCCGAGAACGGACG
GCGGCGTGA
Transcript >Hirsu2|7724
ATGGGTGTCCTACCCGGATGGTGGCTTGGGGTCGCGGACGGTCGGATCAGCGAGCCGTGCCCGGCACCGGAACGC
TGGGACACGGTGCTCAAGGAGGCCGGCTTCACCGGTGTTGAAGCTGCCACGTACGACGCGCCACCTCCCTACCAT
TTCGTCCAGAGTATTGTCTCGCGGCCGGCCGTCCCCGACAAGAGCATGCCCGCGGCAGCCGGCCCGCCTGCACCT
CGCCGTCGGCTGACTCTGCTTCACCGCTCAGGCGACGGAGCTTCTCCCAACGTTGTGCGGATGCACGCTGTCCTC
GGCGACAGCGGCTTTGAGGTTGACATGTTCGGGATGCACGAGTATCAGCGGGCCATGACCCGCGATCGCGACATC
ATCGTTGCACTGGTCGAGCTCGAGACGCCCTTTTTCGAGGGCATGTCGGGACTAGACCTGGCAGCCTTCCAGAAA
CTCGCTGCGGGCCTGGGCGTCACGCCAGTGCTTTGGGTTATGGGCCCGGCGCAAGCAGGCGTCGGTCCATCGGGC
AGCCCCGGCTTCGGTCTGACTCTGGGGCTGATGCGGTCGCTACGCTCCGAGCAGCCTGTGGCCATTACCACGCTG
GAAGTAGACCACGTCGACGACAGGGCGTTCGCAGCTGTCTCCAGCATTGTGGAGAGGCTTCTGCTGGAGCGCACT
GATGGGGCCGAATTTTCAAAGGCTGCGTCCCCGACGGACCTGGATCGGGAGTTTGTGCTTGCTGATGGGGTCGTC
AAAGTCGGAAGATATTATCCCGTGTCCCTGTCGCAGCAGGATCAGGATCCAACGACGAAAGAACGCAAGCCTGGG
CCCTTGGCTCTCGATATAGGGCGTACGGGCTCGTTGCAGACACTGAGATGGGTGCCTGCCCCTTCTTGTGAGCCG
GCACATGGCGAGGTCATGGTCGAGCCTCGATGCGCAGGTTTGAACTTTCAGGTAGGCAGCACTCCGTACCCCTCC
AACTGCTTCTCTCTGTCATCGGTCCGTCTTGTCTCACATTCTCGCGGACTCTTTGTTCGGGAGACAAGACGGACA
CTGGGATCACCAACTGACTGGGTTCAGGACGTGCTCCACTGCATGGGCCTCCTGGCCTTGCCAGATGGGAGCTTC
GGCACGGAAGGGTCCGGTGTTGTCACCAAGGTAGGGAGCGGTGTCGCAGACCTACGGCCGGGGGACCGAGTCTTG
TACATGGCGCGCCATTGCTTCTCGACTCAAGCTACAATGTCGGCTCAACGATGCGTCAGAATAGGACCGTCGCTG
TCGTGGGAGAACGCAGCGACAATGCCGTGCGCGTACGCCACCGCCATCCATTGTCTGCTGGACGTCGGGGATCTG
CGGCCCGGTCAGTCGATTTTGATTCACTCGGCGTGCGGCGGCGTCGGCATCGCGGCTCTCAACGTGTGCCGGAGC
ATCGGGGGCTTGGAGGTGTACGCCACGGCGGGCAACGCCGAAAAGGTCAAGCACTTGATGGATGTGTTCGGCCTT
GCCCGCGACAGAATCTTTAGCTCCCGCGACACGACCTTTGTCGACGGTGTACGGGCCGCCACTGGTGGGCGTGGC
GTCGACTTGGTCCTTAACAGCCTTTCTGGAGAGCTACTCCACGCATCGTGGCAGTGCGTGGCACCATACGGCAAG
ATGCTGGAGATCAGTAAGAGGGATTCGATTGGCAAGGCGCGGCTGGGCATGGACCTGTTCGAGGCCAACAGAAGC
TTCATCGGTATCGACGTGGCCAGGTTTGATGCGGCGAAATGTCACCGACTGCTCCAGCGCACCGTGGATATGTTC
GAGTGCGGCACTATCGGGCCAATCGAACCCGTCAAGCTGTTTGAGGCGGCAGATGTGGAGGCCGCATTCCGCTAC
ATGCAGCAGGGAACCCACCTCGGCAAGGTTGTCGTGAGCATTCCCGAGAACGGGCACGGTCTCGCCGCGACTCTG
GAGCCACCGCAGACGGAGCTCAACCCCCAAGGCACATACCTTCTCGTGGGCGGCCTGGGCGGCCTGGGTCGCGTC
ATCGCGACGTGGATGGTCGAGAGAGGAGCGCGACATCTTCTCTTCTTGTCGCGGTCGGCGGGCCTCAGCGCGCGC
GACCAGGCCTTCTTCCGCGAGCTGGAGTGCCAGGGCTGCACAGCGCGAGCAGTCAGGGGCAGTGTCACGGACAAG
GCCGTTGTCGAGCGTGCCATGGCCTCGGCGCCCCCGGATCAGCCCGTCAGGGGCGTCCTGCAGATGTCGATGGTG
GTTCAACTCGTACCAGTTGCCAATATGGGCCTGGCGGATTGGGAGGCTTCTGTGAGACCCAAGGCAGAGGGGACG
TGTAATCTTCACGTGGCCGCGCCCAAAGACCTCGACTTCTTCCTCGCGCTTGGGTCTATGACGGGATCCTTTGGT
GTGCCGTGCGCGGCCAACTATTCCGCCGGCAACACGTACCTCACAGCTGTGGCTCAACATCGGCGAGCGCTGGGC
CTGCCGGCGTCGGTCTTGCACCTCGGCTTCGTCGAGGACAGTGGCTACCTTGCTCGCAGCCTGGGGGTCGGCGAG
ATGTACCGACTGGCCGGCAGCTACTACTTACGCACCCAGCACGTACTCGAAGAGCTCAACCGGGCGCTGACTGCC
AGCAAGCCCTGGGAGCTCGAGCGTCAGCTCACGACTGGGGTGCGTCATACAAAGCCACTCTCGGACCCGACCAAC
CATGTGTTGTGGAAGAGGGATGCCCGCATGAGGCTCTACCACAACGAGAGAGGCTCATGCGCCGCTGCGACGGAC
GGTGAAGACAAGGACGATACGCTCTCCCGGGTCATTGCCGCGTTTGGGATGGAGCCAAGCCTCCTCGACCCGCCG
GCTTCGCTGGAGCTCGGAGCGCCCAAGTTCGAGAGCGCGCTCGAAGCCTTCGGCACCGACCCCTTGCTCAAGCCT
TTCTTAGAGCAGTTAATAGGGGATTTCCCCGAGGCGCGGTCGGCAGCGGAGGAGGCGCATGCCCGAGAACGGACG
GCGGCGTGA
Gene >Hirsu2|7724
ATGGGTGTCCTACCCGGATGGTGGCTTGGGGTCGCGGACGGTCGGATCAGCGAGCCGTGCCCGGCACCGGAACGC
TGGGACACGGTGCTCAAGGAGGCCGGCTTCACCGGTGTTGAAGCTGCCACGTACGACGCGCCACCTCCCTACCAT
TTCGTCCAGAGTATTGTCTCGCGGCCGGCCGTCCCCGACAAGAGCATGCCCGCGGCAGCCGGCCCGCCTGCACCT
CGCCGTCGGCTGACTCTGCTTCACCGCTCAGGCGACGGAGCTTCTCCCAACGTTGTGCGGATGCACGCTGTCCTC
GGCGACAGCGGCTTTGAGGTTGACATGTTCGGGATGCACGAGTATCAGCGGGCCATGACCCGCGATCGCGACATC
ATCGTTGCACTGGTCGAGCTCGAGACGCCCTTTTTCGAGGGCATGTCGGGACTAGACCTGGCAGCCTTCCAGAAA
CTCGCTGCGGGCCTGGGCGTCACGCCAGTGCTTTGGGTTATGGGCCCGGCGCAAGCAGGCGTCGGTCCATCGGGC
AGCCCCGGCTTCGGTCTGACTCTGGGGCTGATGCGGTCGCTACGCTCCGAGCAGCCTGTGGCCATTACCACGCTG
GAAGTAGACCACGTCGACGACAGGGCGTTCGCAGCTGTCTCCAGCATTGTGGAGAGGCTTCTGCTGGAGCGCACT
GATGGGGCCGAATTTTCAAAGGCTGCGTCCCCGACGGACCTGGATCGGGAGTTTGTGCTTGCTGATGGGGTCGTC
AAAGTCGGAAGATATTATCCCGTGTCCCTGTCGCAGCAGGATCAGGATCCAACGACGAAAGAACGCAAGCCTGGG
CCCTTGGCTCTCGATATAGGGCGTACGGGCTCGTTGCAGACACTGAGATGGGTGCCTGCCCCTTCTTGTGAGCCG
GCACATGGCGAGGTCATGGTCGAGCCTCGATGCGCAGGTTTGAACTTTCAGGTAGGCAGCACTCCGTACCCCTCC
AACTGCTTCTCTCTGTCATCGGTCCGTCTTGTCTCACATTCTCGCGGACTCTTTGTTCGGGAGACAAGACGGACA
CTGGGATCACCAACTGACTGGGTTCAGGACGTGCTCCACTGCATGGGCCTCCTGGCCTTGCCAGATGGGAGCTTC
GGCACGGAAGGGTCCGGTGTTGTCACCAAGGTAGGGAGCGGTGTCGCAGACCTACGGCCGGGGGACCGAGTCTTG
TACATGGCGCGCCATTGCTTCTCGACTCAAGCTACAATGTCGGCTCAACGATGCGTCAGAATAGGACCGTCGCTG
TCGTGGGAGAACGCAGCGACAATGCCGTGCGCGTACGCCACCGCCATCCATTGTCTGCTGGACGTCGGGGATCTG
CGGCCCGGTCAGTCGATTTTGATTCACTCGGCGTGCGGCGGCGTCGGCATCGCGGCTCTCAACGTGTGCCGGAGC
ATCGGGGGCTTGGAGGTGAGATTTTGGCCTGATAGCCTTTCTCGAGACTGCCAGCCCGAGTCTCCAGCTGACCCC
CCCTTCCGCAGGTGTACGCCACGGCGGGCAACGCCGAAAAGGTCAAGCACTTGATGGATGTGTTCGGCCTTGCCC
GCGACAGAATCTTTAGCTCCCGCGACACGACCTTTGTCGACGGTGTACGGGCCGCCACTGGTGGGCGTGGCGTCG
ACTTGGTCCTTAACAGCCTTTCTGGAGAGCTACTCCACGCATCGTGGCAGTGCGTGGCACCATACGGCAAGATGC
TGGAGATCAGTAAGAGGGATTCGATTGGCAAGGCGCGGCTGGGCATGGACCTGTTCGAGGCCAACAGAAGCTTCA
TCGGTATCGACGTGGCCAGGTTTGATGCGGCGAAATGTCACCGGTGGGTTCCGCAACCTCCTGAGAGGCCGCGTC
TATCAGGCTGATGCCCCTGGACTATCACCCAGACTGCTCCAGCGCACCGTGGATATGTTCGAGTGCGGCACTATC
GGGCCAATCGAACCCGTCAAGCTGTTTGAGGCGGCAGATGTGGAGGCCGCATTCCGCTACATGCAGCAGGGAACC
CACCTCGGCAAGGTTGTCGTGAGCATTCCCGAGAACGGGCACGGTCTCGCCGCGACTCTGGAGCCACCGCAGACG
GAGCTCAACCCCCAAGGCACATACCTTCTCGTGGGCGGCCTGGGCGGCCTGGGTCGCGTCATCGCGACGTGGATG
GTCGAGAGAGGAGCGCGACATCTTCTCTTCTTGTCGCGGTCGGCGGGCCTCAGCGCGCGCGACCAGGCCTTCTTC
CGCGAGCTGGAGTGCCAGGGCTGCACAGCGCGAGCAGTCAGGGGCAGTGTCACGGACAAGGCCGTTGTCGAGCGT
GCCATGGCCTCGGCGCCCCCGGATCAGCCCGTCAGGGGCGTCCTGCAGATGTCGATGGTGGTTCAACTCGTACCA
GTTGCCAATATGGGCCTGGCGGATTGGGAGGCTTCTGTGAGACCCAAGGCAGAGGGGACGTGTAATCTTCACGTG
GCCGCGCCCAAAGACCTCGACTTCTTCCTCGCGCTTGGGTCTATGACGGGATCCTTTGGTGTGCCGTGCGCGGCC
AACTATTCCGCCGGCAACACGTACCTCACAGCTGTGGCTCAACATCGGCGAGCGCTGGGCCTGCCGGCGTCGGTC
TTGCACCTCGGCTTCGTCGAGGACAGTGGCTACCTTGCTCGCAGCCTGGGGGTCGGCGAGATGTACCGACTGGCC
GGCAGCTACTACTTACGCACCCAGCACGTACTCGAAGAGCTCAACCGGGCGCTGACTGCCAGCAAGCCCTGGGAG
CTCGAGCGTCAGCTCACGACTGGGGTGCGTCATACAAAGCCACTCTCGGACCCGACCAACCATGTGTTGTGGAAG
AGGGATGCCCGCATGAGGCTCTACCACAACGAGAGAGGCTCATGCGCCGCTGCGACGGACGGTGAAGACAAGGAC
GATACGCTCTCCCGGGTCATTGCCGCGTTTGGGATGGAGCCAAGCCTCCTCGACCCGCCGGCTTCGCTGGAGCTC
GGAGCGCCCAAGTTCGAGAGCGCGCTCGAAGCCTTCGGCACCGACCCCTTGCTCAAGCCTTTCTTAGAGCAGTTA
ATAGGGGATTTCCCCGAGGCGCGGTCGGCAGCGGAGGAGGCGCATGCCCGAGAACGGACGGCGGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail