Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7721
Gene name
LocationContig_465:12721..17003
Strand-
Gene length (bp)4282
Transcript length (bp)4161
Coding sequence length (bp)4161
Protein length (aa) 1387

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14664 RICTOR_N Rapamycin-insensitive companion of mTOR, N-term 9.4E-134 245 622
PF14666 RICTOR_M Rapamycin-insensitive companion of mTOR, middle domain 1.2E-35 821 921
PF14663 RasGEF_N_2 Rapamycin-insensitive companion of mTOR RasGEF_N domain 1.3E-34 939 1042
PF14668 RICTOR_V Rapamycin-insensitive companion of mTOR, domain 5 3.4E-28 1116 1185
PF02185 HR1 Hr1 repeat 1.8E-15 114 178

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09743|STE16_SCHPO Protein ste16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste16 PE=3 SV=1 245 1326 0.0E+00
sp|O77203|PIAA_DICDI Protein pianissimo A OS=Dictyostelium discoideum GN=piaA PE=1 SV=1 231 1322 5.0E-114
sp|P40061|TSC11_YEAST Target of rapamycin complex 2 subunit TSC11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSC11 PE=1 SV=1 221 1208 3.0E-113
sp|Q6QI06|RICTR_MOUSE Rapamycin-insensitive companion of mTOR OS=Mus musculus GN=Rictor PE=1 SV=2 218 1206 5.0E-108
sp|Q6R327|RICTR_HUMAN Rapamycin-insensitive companion of mTOR OS=Homo sapiens GN=RICTOR PE=1 SV=1 218 1206 2.0E-107

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0008150 biological_process No
GO:0065007 biological regulation No
GO:0050794 regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7721
MPAPSSQQNAHHHNQQQQQQQQPGRSSFDRDAGALQLPPNGGPPRKMSAPAMSFAPRGSGLNPNPGPGSFSSELR
SQMLSSRAGSRVDIGSSFSAGAPDKVEDDGSAAAMEQALSVLRERLNREMKIKEGSENMLEALNIKKAKQTKEQR
QRVEAELSASNSRIKELRQKILDAQRSKPVPPSTPTRNRTHDGLLLSSGHLRSPPSISRSAMGSDIDEMMESPTF
LLAEFLQALEVEGMAPEYYVSRANQLVELFKRHPAIKYDLVWSIFGLRMQMMLLSESREVVAAGYRATRYAMTDV
ASLKKIRNLNTDYLVIRSLNNYRKADVEREQALKFVRAFLDVKDGVREISRAVVRTIVAVAEQGEERRPGGANVA
DHNIDRLRPICIETLAEILVGDPQLLIASGGLGPLSEALGEGTYKAPESLMSAFLFLLDTPGKRKYIQPGYGLDV
VFTAFTDQLAGAESILKQNSRAISVAMKSWSGLMTLGMYDFRPIRSLIASILFPNSAIRETVLDLLFSLLRIKPP
AWATSFLAGRRLTTYGRVANMKSTNGRERSATLSLEEDSGEQNFVDHYTALLLAVFIQAGLLQRLLQIAQSEEDS
MLKRKTTLLIGEVLKLASRLLPPAWSAELQLLPELFSAAAQFGNEAHFVASGIVYQISSVSRTLYRSAPSESMAG
ALPSSDSMQHLAMFEEHPKANAAMVFDDATFRQLLIDTGVLNSSNYLKWNWEVIIKVIDGPLQIGKRLEEAIRAS
KFMKRIMSFYRPFKYKFAEIKNTRNTQKYVRAGCALVHSLLQSTEGVRVLADSKLLRQIAECLAQCDPTSGLTAQ
FPMFAKDRLTDTLCGGYFPMLGVLSSYSQGLLLLERWRMFNMMYHIVDLKQRPDLIKLLLSNFDYSLQGHPRVLL
SKALIAGNKNIRIHATNTLRKCTMRPVTSLSGQGNASDAKWAIQLLVTQLYDPEIEVCSTAVKILENACNRKVFL
EYIVECRPALDHLGEIGAPLLLRFLSTSIGYHYLDGLDYISNEMDDWFLGRNDSYVDVIEASLARAFLAGPDDHG
HRVSLFNEAEAETDFHDSHVPPHFYRELTRTREGCKLLSDKGHFEEFVATIRDHGMQTEDGELMTKVKGCLWAVG
NVGSMELGAPFLEASDVVERIIDIAESHEVMSLRGTAFFVLGLISRSTHGLEILSEHGWDANTTSMGASLGFCIP
NDLSRLFSMRPWQHVKAASIKLLDTQRTAREQPSVRQARPPLEPSEMPPLVSEADINERIMELVVDLGNMVLYKK
AVGELQKLKTRKPNAFRSTDFFKKVMGLMEWNHYRLGVRRLVIDLFEKHVMRQIVFGEDEGSGGGNGDVGPAGDD
SGDGSSGDDRTERQRSISEPAEMPSDLMPAPLKVRR*
Coding >Hirsu2|7721
ATGCCCGCCCCATCCTCCCAGCAGAATGCCCACCATCACAACCAGCAGCAGCAGCAGCAGCAGCAGCCCGGCCGA
TCCAGCTTCGACCGCGATGCCGGCGCTCTGCAGCTCCCTCCCAATGGCGGCCCGCCACGCAAGATGTCCGCCCCT
GCCATGTCCTTTGCGCCCCGCGGCAGCGGCCTGAACCCCAACCCGGGTCCGGGCAGCTTCAGCTCCGAACTGCGA
AGCCAGATGCTCTCGAGCCGTGCCGGCAGCCGCGTCGACATAGGCTCCTCATTCTCTGCTGGCGCCCCCGACAAG
GTGGAAGACGACGGCTCCGCGGCCGCCATGGAGCAAGCCTTGTCTGTGCTCAGGGAGAGGCTGAACCGAGAGATG
AAGATCAAGGAGGGTAGCGAAAACATGCTCGAGGCGCTGAACATTAAGAAGGCCAAGCAGACCAAGGAGCAGCGG
CAAAGAGTCGAGGCAGAGCTGAGCGCCAGCAATTCCAGGATTAAGGAGCTGCGGCAAAAGATTTTGGACGCTCAG
CGCTCCAAGCCGGTCCCTCCATCCACCCCGACCAGAAATCGGACCCATGATGGCCTGCTGCTGTCTAGCGGACAC
CTGCGCTCGCCCCCTAGCATCTCGCGCTCCGCCATGGGCTCCGACATAGACGAGATGATGGAGAGCCCAACCTTC
TTGCTGGCCGAGTTCCTGCAGGCTCTCGAGGTCGAGGGCATGGCACCCGAGTACTATGTGAGCAGGGCCAACCAG
CTGGTCGAACTCTTCAAGCGACACCCGGCCATCAAGTACGACCTCGTCTGGTCCATCTTCGGGCTGCGCATGCAA
ATGATGTTGCTCAGCGAGAGCCGCGAGGTCGTCGCTGCTGGCTACCGAGCCACTCGATACGCCATGACGGACGTG
GCCTCCTTAAAAAAGATCCGCAACCTCAACACTGATTATCTAGTGATAAGGTCGCTCAACAACTATCGCAAAGCC
GACGTGGAACGCGAGCAGGCTCTCAAGTTCGTGCGGGCCTTCCTTGACGTCAAGGACGGCGTCAGGGAAATCTCT
CGGGCCGTAGTGCGCACCATTGTCGCGGTCGCCGAGCAGGGTGAGGAACGTCGCCCCGGCGGCGCTAATGTCGCC
GACCACAATATTGATCGGCTGCGCCCAATATGCATCGAGACGCTCGCAGAAATACTGGTGGGCGATCCGCAGCTC
CTCATTGCATCGGGCGGCCTTGGGCCCCTCTCGGAAGCTTTGGGCGAGGGCACATACAAGGCCCCGGAGAGCTTG
ATGTCTGCTTTCCTCTTCCTCCTCGACACGCCCGGCAAACGCAAATACATTCAGCCCGGCTACGGCTTGGACGTC
GTGTTTACCGCCTTCACCGACCAGCTCGCCGGGGCGGAGAGCATTCTCAAACAGAACTCCAGAGCCATATCCGTT
GCCATGAAGTCGTGGTCCGGCCTGATGACCCTTGGCATGTACGATTTTCGGCCGATCCGTTCGCTCATCGCGAGC
ATATTGTTTCCCAACTCAGCAATACGCGAGACTGTTCTGGACCTGCTGTTCTCCCTGCTGCGGATCAAGCCACCT
GCCTGGGCCACATCATTCTTAGCCGGACGCCGGTTGACGACATACGGGAGAGTGGCCAATATGAAGTCGACCAAC
GGCAGGGAAAGGAGCGCCACGCTCTCCCTGGAAGAGGACAGCGGCGAGCAGAACTTTGTCGATCACTACACGGCG
CTGCTGCTGGCCGTCTTCATTCAGGCGGGGCTGCTGCAAAGACTGCTGCAGATAGCGCAGTCAGAAGAAGACTCG
ATGCTGAAGCGCAAAACGACACTGCTGATCGGCGAGGTGCTGAAGCTGGCCAGCCGATTACTCCCTCCCGCATGG
AGCGCCGAGCTGCAGCTTCTGCCGGAGCTGTTCTCGGCGGCCGCACAGTTCGGCAACGAGGCTCACTTTGTGGCG
TCGGGCATCGTCTACCAGATCAGCAGCGTCAGTAGGACGCTGTACAGGAGCGCCCCGTCCGAGTCCATGGCCGGC
GCCCTGCCATCCAGCGACAGCATGCAACACCTGGCAATGTTCGAGGAACACCCCAAGGCCAACGCGGCCATGGTC
TTCGACGATGCAACGTTCCGCCAGCTCCTCATCGACACGGGCGTCCTCAACAGTTCCAACTACTTGAAGTGGAAC
TGGGAGGTCATCATCAAGGTCATAGACGGGCCCTTGCAGATCGGGAAGCGGCTGGAAGAGGCCATCAGGGCTTCG
AAGTTCATGAAGCGCATCATGAGCTTCTACAGGCCCTTCAAGTACAAGTTCGCCGAGATCAAGAACACGAGGAAC
ACGCAGAAGTACGTCAGAGCCGGCTGTGCGCTGGTGCATTCTCTGCTCCAGTCGACCGAGGGTGTAAGGGTCTTG
GCGGACAGCAAGCTGCTGAGACAGATCGCCGAGTGTCTTGCCCAGTGCGATCCGACCAGCGGCCTCACCGCGCAG
TTTCCCATGTTTGCAAAGGACCGACTCACGGACACGCTCTGTGGAGGCTACTTCCCCATGCTTGGCGTCCTCAGC
AGCTACTCCCAGGGGTTGCTTCTACTGGAGAGGTGGAGGATGTTCAACATGATGTACCATATCGTCGACCTGAAG
CAGCGGCCCGATCTCATCAAGCTCCTCCTGTCTAACTTTGACTACAGCCTTCAGGGCCACCCCCGAGTCCTACTT
TCCAAGGCCCTGATCGCGGGCAACAAGAACATTCGAATACACGCGACGAACACACTGCGCAAGTGTACAATGAGG
CCGGTAACCTCGCTCAGCGGCCAGGGCAACGCTAGCGACGCGAAGTGGGCCATTCAGCTCCTCGTCACGCAGCTA
TACGATCCAGAAATCGAGGTCTGCTCCACGGCCGTCAAGATTCTCGAGAACGCGTGCAACCGAAAGGTCTTCCTG
GAATACATCGTCGAGTGTCGGCCCGCCCTCGACCACCTGGGCGAGATCGGGGCACCCCTGCTGCTGCGGTTCTTG
TCCACCTCGATCGGTTATCACTACCTGGACGGGCTGGACTACATCAGCAATGAGATGGACGACTGGTTTCTGGGC
CGGAACGACTCGTACGTCGACGTCATCGAGGCCAGTCTGGCGAGAGCCTTCCTGGCCGGCCCCGACGATCACGGC
CACCGCGTCAGCCTATTCAACGAGGCGGAGGCGGAGACGGACTTTCACGACAGCCACGTGCCGCCGCACTTCTAC
CGAGAGCTCACCCGCACGCGCGAGGGCTGCAAGCTCTTGAGCGATAAGGGCCACTTCGAGGAGTTCGTGGCGACG
ATCCGCGATCACGGCATGCAGACCGAGGACGGCGAGCTGATGACCAAGGTCAAGGGCTGTCTTTGGGCAGTGGGC
AACGTGGGGTCGATGGAGCTCGGGGCGCCGTTCCTGGAAGCGAGCGACGTGGTCGAGCGTATCATCGACATCGCC
GAGTCGCACGAAGTCATGAGTCTGCGCGGCACGGCCTTCTTCGTGCTGGGGCTCATCTCGCGCTCCACCCACGGC
CTGGAGATCCTGTCGGAACACGGATGGGACGCGAACACGACATCGATGGGGGCGTCACTCGGCTTTTGCATCCCC
AACGACCTGTCGAGGCTTTTTTCGATGAGGCCTTGGCAGCACGTCAAGGCCGCGTCCATCAAGCTGCTCGACACG
CAACGGACCGCGCGGGAGCAGCCGTCGGTCCGACAGGCGCGCCCGCCACTGGAGCCGTCAGAGATGCCGCCGCTC
GTCAGTGAGGCGGACATCAATGAACGCATTATGGAGTTGGTGGTGGACTTGGGTAACATGGTGCTGTACAAGAAG
GCGGTGGGCGAGCTGCAGAAGCTCAAGACGCGCAAGCCGAACGCGTTCCGCAGCACTGATTTCTTCAAGAAGGTG
ATGGGTCTGATGGAGTGGAACCACTACCGGCTCGGGGTACGGAGGCTCGTGATTGACCTGTTCGAGAAGCACGTG
ATGCGACAGATCGTGTTTGGCGAGGACGAAGGCAGCGGCGGCGGCAACGGAGATGTTGGGCCAGCGGGAGACGAC
AGCGGCGACGGCAGCTCCGGGGACGACCGGACAGAGAGGCAGAGGAGCATCAGTGAGCCGGCGGAGATGCCGTCG
GATCTAATGCCGGCGCCGCTCAAAGTACGGCGCTGA
Transcript >Hirsu2|7721
ATGCCCGCCCCATCCTCCCAGCAGAATGCCCACCATCACAACCAGCAGCAGCAGCAGCAGCAGCAGCCCGGCCGA
TCCAGCTTCGACCGCGATGCCGGCGCTCTGCAGCTCCCTCCCAATGGCGGCCCGCCACGCAAGATGTCCGCCCCT
GCCATGTCCTTTGCGCCCCGCGGCAGCGGCCTGAACCCCAACCCGGGTCCGGGCAGCTTCAGCTCCGAACTGCGA
AGCCAGATGCTCTCGAGCCGTGCCGGCAGCCGCGTCGACATAGGCTCCTCATTCTCTGCTGGCGCCCCCGACAAG
GTGGAAGACGACGGCTCCGCGGCCGCCATGGAGCAAGCCTTGTCTGTGCTCAGGGAGAGGCTGAACCGAGAGATG
AAGATCAAGGAGGGTAGCGAAAACATGCTCGAGGCGCTGAACATTAAGAAGGCCAAGCAGACCAAGGAGCAGCGG
CAAAGAGTCGAGGCAGAGCTGAGCGCCAGCAATTCCAGGATTAAGGAGCTGCGGCAAAAGATTTTGGACGCTCAG
CGCTCCAAGCCGGTCCCTCCATCCACCCCGACCAGAAATCGGACCCATGATGGCCTGCTGCTGTCTAGCGGACAC
CTGCGCTCGCCCCCTAGCATCTCGCGCTCCGCCATGGGCTCCGACATAGACGAGATGATGGAGAGCCCAACCTTC
TTGCTGGCCGAGTTCCTGCAGGCTCTCGAGGTCGAGGGCATGGCACCCGAGTACTATGTGAGCAGGGCCAACCAG
CTGGTCGAACTCTTCAAGCGACACCCGGCCATCAAGTACGACCTCGTCTGGTCCATCTTCGGGCTGCGCATGCAA
ATGATGTTGCTCAGCGAGAGCCGCGAGGTCGTCGCTGCTGGCTACCGAGCCACTCGATACGCCATGACGGACGTG
GCCTCCTTAAAAAAGATCCGCAACCTCAACACTGATTATCTAGTGATAAGGTCGCTCAACAACTATCGCAAAGCC
GACGTGGAACGCGAGCAGGCTCTCAAGTTCGTGCGGGCCTTCCTTGACGTCAAGGACGGCGTCAGGGAAATCTCT
CGGGCCGTAGTGCGCACCATTGTCGCGGTCGCCGAGCAGGGTGAGGAACGTCGCCCCGGCGGCGCTAATGTCGCC
GACCACAATATTGATCGGCTGCGCCCAATATGCATCGAGACGCTCGCAGAAATACTGGTGGGCGATCCGCAGCTC
CTCATTGCATCGGGCGGCCTTGGGCCCCTCTCGGAAGCTTTGGGCGAGGGCACATACAAGGCCCCGGAGAGCTTG
ATGTCTGCTTTCCTCTTCCTCCTCGACACGCCCGGCAAACGCAAATACATTCAGCCCGGCTACGGCTTGGACGTC
GTGTTTACCGCCTTCACCGACCAGCTCGCCGGGGCGGAGAGCATTCTCAAACAGAACTCCAGAGCCATATCCGTT
GCCATGAAGTCGTGGTCCGGCCTGATGACCCTTGGCATGTACGATTTTCGGCCGATCCGTTCGCTCATCGCGAGC
ATATTGTTTCCCAACTCAGCAATACGCGAGACTGTTCTGGACCTGCTGTTCTCCCTGCTGCGGATCAAGCCACCT
GCCTGGGCCACATCATTCTTAGCCGGACGCCGGTTGACGACATACGGGAGAGTGGCCAATATGAAGTCGACCAAC
GGCAGGGAAAGGAGCGCCACGCTCTCCCTGGAAGAGGACAGCGGCGAGCAGAACTTTGTCGATCACTACACGGCG
CTGCTGCTGGCCGTCTTCATTCAGGCGGGGCTGCTGCAAAGACTGCTGCAGATAGCGCAGTCAGAAGAAGACTCG
ATGCTGAAGCGCAAAACGACACTGCTGATCGGCGAGGTGCTGAAGCTGGCCAGCCGATTACTCCCTCCCGCATGG
AGCGCCGAGCTGCAGCTTCTGCCGGAGCTGTTCTCGGCGGCCGCACAGTTCGGCAACGAGGCTCACTTTGTGGCG
TCGGGCATCGTCTACCAGATCAGCAGCGTCAGTAGGACGCTGTACAGGAGCGCCCCGTCCGAGTCCATGGCCGGC
GCCCTGCCATCCAGCGACAGCATGCAACACCTGGCAATGTTCGAGGAACACCCCAAGGCCAACGCGGCCATGGTC
TTCGACGATGCAACGTTCCGCCAGCTCCTCATCGACACGGGCGTCCTCAACAGTTCCAACTACTTGAAGTGGAAC
TGGGAGGTCATCATCAAGGTCATAGACGGGCCCTTGCAGATCGGGAAGCGGCTGGAAGAGGCCATCAGGGCTTCG
AAGTTCATGAAGCGCATCATGAGCTTCTACAGGCCCTTCAAGTACAAGTTCGCCGAGATCAAGAACACGAGGAAC
ACGCAGAAGTACGTCAGAGCCGGCTGTGCGCTGGTGCATTCTCTGCTCCAGTCGACCGAGGGTGTAAGGGTCTTG
GCGGACAGCAAGCTGCTGAGACAGATCGCCGAGTGTCTTGCCCAGTGCGATCCGACCAGCGGCCTCACCGCGCAG
TTTCCCATGTTTGCAAAGGACCGACTCACGGACACGCTCTGTGGAGGCTACTTCCCCATGCTTGGCGTCCTCAGC
AGCTACTCCCAGGGGTTGCTTCTACTGGAGAGGTGGAGGATGTTCAACATGATGTACCATATCGTCGACCTGAAG
CAGCGGCCCGATCTCATCAAGCTCCTCCTGTCTAACTTTGACTACAGCCTTCAGGGCCACCCCCGAGTCCTACTT
TCCAAGGCCCTGATCGCGGGCAACAAGAACATTCGAATACACGCGACGAACACACTGCGCAAGTGTACAATGAGG
CCGGTAACCTCGCTCAGCGGCCAGGGCAACGCTAGCGACGCGAAGTGGGCCATTCAGCTCCTCGTCACGCAGCTA
TACGATCCAGAAATCGAGGTCTGCTCCACGGCCGTCAAGATTCTCGAGAACGCGTGCAACCGAAAGGTCTTCCTG
GAATACATCGTCGAGTGTCGGCCCGCCCTCGACCACCTGGGCGAGATCGGGGCACCCCTGCTGCTGCGGTTCTTG
TCCACCTCGATCGGTTATCACTACCTGGACGGGCTGGACTACATCAGCAATGAGATGGACGACTGGTTTCTGGGC
CGGAACGACTCGTACGTCGACGTCATCGAGGCCAGTCTGGCGAGAGCCTTCCTGGCCGGCCCCGACGATCACGGC
CACCGCGTCAGCCTATTCAACGAGGCGGAGGCGGAGACGGACTTTCACGACAGCCACGTGCCGCCGCACTTCTAC
CGAGAGCTCACCCGCACGCGCGAGGGCTGCAAGCTCTTGAGCGATAAGGGCCACTTCGAGGAGTTCGTGGCGACG
ATCCGCGATCACGGCATGCAGACCGAGGACGGCGAGCTGATGACCAAGGTCAAGGGCTGTCTTTGGGCAGTGGGC
AACGTGGGGTCGATGGAGCTCGGGGCGCCGTTCCTGGAAGCGAGCGACGTGGTCGAGCGTATCATCGACATCGCC
GAGTCGCACGAAGTCATGAGTCTGCGCGGCACGGCCTTCTTCGTGCTGGGGCTCATCTCGCGCTCCACCCACGGC
CTGGAGATCCTGTCGGAACACGGATGGGACGCGAACACGACATCGATGGGGGCGTCACTCGGCTTTTGCATCCCC
AACGACCTGTCGAGGCTTTTTTCGATGAGGCCTTGGCAGCACGTCAAGGCCGCGTCCATCAAGCTGCTCGACACG
CAACGGACCGCGCGGGAGCAGCCGTCGGTCCGACAGGCGCGCCCGCCACTGGAGCCGTCAGAGATGCCGCCGCTC
GTCAGTGAGGCGGACATCAATGAACGCATTATGGAGTTGGTGGTGGACTTGGGTAACATGGTGCTGTACAAGAAG
GCGGTGGGCGAGCTGCAGAAGCTCAAGACGCGCAAGCCGAACGCGTTCCGCAGCACTGATTTCTTCAAGAAGGTG
ATGGGTCTGATGGAGTGGAACCACTACCGGCTCGGGGTACGGAGGCTCGTGATTGACCTGTTCGAGAAGCACGTG
ATGCGACAGATCGTGTTTGGCGAGGACGAAGGCAGCGGCGGCGGCAACGGAGATGTTGGGCCAGCGGGAGACGAC
AGCGGCGACGGCAGCTCCGGGGACGACCGGACAGAGAGGCAGAGGAGCATCAGTGAGCCGGCGGAGATGCCGTCG
GATCTAATGCCGGCGCCGCTCAAAGTACGGCGCTGA
Gene >Hirsu2|7721
ATGCCCGCCCCATCCTCCCAGCAGAATGCCCACCATCACAACCAGCAGCAGCAGCAGCAGCAGCAGCCCGGCCGA
TCCAGCTTCGACCGCGATGCCGGCGCTCTGCAGCTCCCTCCCAATGGCGGCCCGCCACGCAAGATGTCCGCCCCT
GCCATGTCCTTTGCGCCCCGCGGCAGCGGCCTGAACCCCAACCCGGGTCCGGGCAGCTTCAGCTCCGAACTGCGA
AGCCAGATGCTCTCGAGCCGTGCCGGCAGCCGCGTCGACATAGGCTCCTCATTCTCTGCTGGCGCCCCCGACAAG
GTGGAAGACGACGGCTCCGCGGCCGCCATGGAGCAAGCCTTGTCTGTGCTCAGGGAGAGGCTGAACCGAGAGATG
AAGATCAAGGAGGGTAGCGAAAACATGCTCGAGGCGCTGAACATTAAGAAGGCCAAGCAGACCAAGGAGCAGCGG
CAAAGAGTCGAGGCAGAGCTGAGCGCCAGCAATTCCAGGATTAAGGAGCTGCGGCAAAAGATTTTGGACGCTCAG
CGCTCCAAGCCGGTCCCTCCATCCACCCCGACCAGAAATCGGACCCATGATGGCCTGCTGCTGTCTAGCGGACAC
CTGCGCTCGCCCCCTAGCATCTCGCGCTCCGCCATGGGCTCCGACATAGACGAGATGATGGAGAGCCCAACCTTC
TTGCTGGCCGAGTTCCTGCAGGCTCTCGAGGTCGAGGGCATGGCACCCGAGTACTATGTGAGCAGGGCCAACCAG
CTGGTCGAACTCTTCAAGCGACACCCGGCCATCAAGTACGACCTCGTCTGGTCCATCTTCGGGCTGCGCATGCAA
ATGATGTTGCTCAGCGAGAGCCGCGAGGTCGTCGCTGCTGGCTACCGAGCCACTCGATACGCCATGACGGACGTG
GCCTCCTTAAAAAAGATCCGCAACCTCAACACTGATTATCTAGTGATAAGGTGAAGTCTCGCCCCCTCCCTCCGT
TGGGGATTCTACTTCTGACTGGCACTCTCAGGTCGCTCAACAACTATCGCAAAGCCGACGTGGAACGCGAGCAGG
CTCTCAAGTTCGTGCGGGCCTTCCTTGACGTCAAGGACGGCGTCAGGGAAATCTCTCGGGCCGTAGTGCGCACCA
TTGTCGCGGTCGCCGAGCAGGGTGAGGAACGTCGCCCCGGCGGCGCTAATGTCGCCGACCACAATATTGATCGGC
TGCGCCCAATATGCATCGAGACGCTCGCAGAAATACTGGTGGGCGATCCGCAGCTCCTCATTGCATCGGGCGGCC
TTGGGCCCCTCTCGGAAGCTTTGGGCGAGGGCACATACAAGGCCCCGGAGAGCTTGATGTCTGCTTTCCTCTTCC
TCCTCGACACGCCCGGCAAACGCAAATACATTCAGCCCGGCTACGGCTTGGACGTCGTGTTTACCGCCTTCACCG
ACCAGCTCGCCGGGGCGGAGAGCATTCTCAAACAGAACTCCAGAGCCATATCCGTTGCCATGAAGTCGTGGTCCG
GCCTGATGACCCTTGGCATGTACGATTTTCGGCCGATCCGTTCGCTCATCGCGAGCATATTGTTTCCCAACTCAG
CAATACGCGAGACTGTTCTGGACCTGCTGTTCTCCCTGCTGCGGATCAAGCCACCTGCCTGGGCCACATCATTCT
TAGCCGGACGCCGGTTGACGACATACGGGAGAGTGGCCAATATGAAGTCGACCAACGGCAGGGAAAGGAGCGCCA
CGCTCTCCCTGGAAGAGGACAGCGGCGAGCAGAACTTTGTCGATCACTACACGGCGCTGCTGCTGGCCGTCTTCA
TTCAGGCGGGGCTGCTGCAAAGACTGCTGCAGATAGCGCAGTCAGAAGAAGACTCGATGCTGAAGCGCAAAACGA
CACTGCTGATCGGCGAGGTGCTGAAGCTGGCCAGCCGATTACTCCCTCCCGCATGGAGCGCCGAGCTGCAGCTTC
TGCCGGAGCTGTTCTCGGCGGCCGCACAGTTCGGCAACGAGGCTCACTTTGTGGCGTCGGGCATCGTCTACCAGA
TCAGCAGCGTCAGTAGGACGCTGTACAGGAGCGCCCCGTCCGAGTCCATGGCCGGCGCCCTGCCATCCAGCGACA
GCATGCAACACCTGGCAATGTTCGAGGAACACCCCAAGGCCAACGCGGCCATGGTCTTCGACGATGCAACGTTCC
GCCAGCTCCTCATCGACACGGGCGTCCTCAACAGTTCCAACTACTTGAAGTGGAACTGGGAGGTCATCATCAAGG
TCATAGACGGGCCCTTGCAGATCGGGAAGCGGCTGGAAGAGGCCATCAGGGCTTCGAAGTTCATGAAGCGCATCA
TGAGCTTCTACAGGCCCTTCAAGTACAAGTTCGCCGAGATCAAGAACACGAGGAACACGCAGAAGTACGTCAGAG
CCGGCTGTGCGCTGGTGCATTCTCTGCTCCAGTCGACCGAGGGTGTAAGGGTCTTGGCGGACAGCAAGCTGCTGA
GACAGATCGCCGAGTGTCTTGCCCAGTGCGATCCGGCAAGTTCCACAACACGGGCTAGACGGACATGTCGCACGG
GGGCGTCGGCTAACAACACTCGCAGACCAGCGGCCTCACCGCGCAGTTTCCCATGTTTGCAAAGGACCGACTCAC
GGACACGCTCTGTGGAGGCTACTTCCCCATGCTTGGCGTCCTCAGCAGCTACTCCCAGGGGTTGCTTCTACTGGA
GAGGTGGAGGATGTTCAACATGATGTACCATATCGTCGACCTGAAGCAGCGGCCCGATCTCATCAAGCTCCTCCT
GTCTAACTTTGACTACAGCCTTCAGGGCCACCCCCGAGTCCTACTTTCCAAGGCCCTGATCGCGGGCAACAAGAA
CATTCGAATACACGCGACGAACACACTGCGCAAGTGTACAATGAGGCCGGTAACCTCGCTCAGCGGCCAGGGCAA
CGCTAGCGACGCGAAGTGGGCCATTCAGCTCCTCGTCACGCAGCTATACGATCCAGAAATCGAGGTCTGCTCCAC
GGCCGTCAAGATTCTCGAGAACGCGTGCAACCGAAAGGTCTTCCTGGAATACATCGTCGAGTGTCGGCCCGCCCT
CGACCACCTGGGCGAGATCGGGGCACCCCTGCTGCTGCGGTTCTTGTCCACCTCGATCGGTTATCACTACCTGGA
CGGGCTGGACTACATCAGCAATGAGATGGACGACTGGTTTCTGGGCCGGAACGACTCGTACGTCGACGTCATCGA
GGCCAGTCTGGCGAGAGCCTTCCTGGCCGGCCCCGACGATCACGGCCACCGCGTCAGCCTATTCAACGAGGCGGA
GGCGGAGACGGACTTTCACGACAGCCACGTGCCGCCGCACTTCTACCGAGAGCTCACCCGCACGCGCGAGGGCTG
CAAGCTCTTGAGCGATAAGGGCCACTTCGAGGAGTTCGTGGCGACGATCCGCGATCACGGCATGCAGACCGAGGA
CGGCGAGCTGATGACCAAGGTCAAGGGCTGTCTTTGGGCAGTGGGCAACGTGGGGTCGATGGAGCTCGGGGCGCC
GTTCCTGGAAGCGAGCGACGTGGTCGAGCGTATCATCGACATCGCCGAGTCGCACGAAGTCATGAGTCTGCGCGG
CACGGCCTTCTTCGTGCTGGGGCTCATCTCGCGCTCCACCCACGGCCTGGAGATCCTGTCGGAACACGGATGGGA
CGCGAACACGACATCGATGGGGGCGTCACTCGGCTTTTGCATCCCCAACGACCTGTCGAGGCTTTTTTCGATGAG
GCCTTGGCAGCACGTCAAGGCCGCGTCCATCAAGCTGCTCGACACGCAACGGACCGCGCGGGAGCAGCCGTCGGT
CCGACAGGCGCGCCCGCCACTGGAGCCGTCAGAGATGCCGCCGCTCGTCAGTGAGGCGGACATCAATGAACGCAT
TATGGAGTTGGTGGTGGACTTGGGTAACATGGTGCTGTACAAGAAGGCGGTGGGCGAGCTGCAGAAGCTCAAGAC
GCGCAAGCCGAACGCGTTCCGCAGCACTGATTTCTTCAAGAAGGTGATGGGTCTGATGGAGTGGAACCACTACCG
GCTCGGGGTACGGAGGCTCGTGATTGACCTGTTCGAGAAGCACGTGATGCGACAGATCGTGTTTGGCGAGGACGA
AGGCAGCGGCGGCGGCAACGGAGATGTTGGGCCAGCGGGAGACGACAGCGGCGACGGCAGCTCCGGGGACGACCG
GACAGAGAGGCAGAGGAGCATCAGTGAGCCGGCGGAGATGCCGTCGGATCTAATGCCGGCGCCGCTCAAAGTACG
GCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail