Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7717
Gene name
LocationContig_465:254..1987
Strand-
Gene length (bp)1733
Transcript length (bp)1605
Coding sequence length (bp)1605
Protein length (aa) 535

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 8.4E-54 71 405
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 1.1E-10 235 318

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|F2Z699|NDH2_YARLI External alternative NADH-ubiquinone oxidoreductase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NDH2 PE=1 SV=1 10 534 0.0E+00
sp|O14121|NDH1_SCHPO Probable NADH-ubiquinone oxidoreductase C3A11.07, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A11.07 PE=3 SV=1 13 532 3.0E-172
sp|P40215|NDH1_YEAST External NADH-ubiquinone oxidoreductase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDE1 PE=1 SV=1 32 532 1.0E-144
sp|O43090|NDH2_SCHPO Probable NADH-ubiquinone oxidoreductase C947.15c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.15c PE=3 SV=1 41 529 7.0E-141
sp|Q07500|NDH2_YEAST External NADH-ubiquinone oxidoreductase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDE2 PE=1 SV=1 15 532 6.0E-122
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|F2Z699|NDH2_YARLI External alternative NADH-ubiquinone oxidoreductase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NDH2 PE=1 SV=1 10 534 0.0E+00
sp|O14121|NDH1_SCHPO Probable NADH-ubiquinone oxidoreductase C3A11.07, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A11.07 PE=3 SV=1 13 532 3.0E-172
sp|P40215|NDH1_YEAST External NADH-ubiquinone oxidoreductase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDE1 PE=1 SV=1 32 532 1.0E-144
sp|O43090|NDH2_SCHPO Probable NADH-ubiquinone oxidoreductase C947.15c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.15c PE=3 SV=1 41 529 7.0E-141
sp|Q07500|NDH2_YEAST External NADH-ubiquinone oxidoreductase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDE2 PE=1 SV=1 15 532 6.0E-122
sp|P32340|NDI1_YEAST Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDI1 PE=1 SV=1 60 530 8.0E-122
sp|Q55CD9|NDH_DICDI Probable NADH dehydrogenase OS=Dictyostelium discoideum GN=DDB_G0270104 PE=3 SV=2 72 532 5.0E-90
sp|M1BYJ7|ENDB1_SOLTU External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Solanum tuberosum GN=NDB1 PE=3 SV=1 37 390 6.0E-89
sp|Q9ST62|NDB1_SOLTU External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Solanum tuberosum GN=NDB1 PE=1 SV=1 37 390 6.0E-88
sp|Q9SKT7|NDB4_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B4, mitochondrial OS=Arabidopsis thaliana GN=NDB4 PE=1 SV=1 69 532 1.0E-82
sp|Q1JPL4|NDB1_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Arabidopsis thaliana GN=NDB1 PE=1 SV=1 51 510 5.0E-82
sp|F4JJJ3|NDB3_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B3, mitochondrial OS=Arabidopsis thaliana GN=NDB3 PE=2 SV=1 40 390 1.0E-80
sp|Q94BV7|NDB2_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial OS=Arabidopsis thaliana GN=NDB2 PE=1 SV=1 30 390 8.0E-77
sp|Q8GWA1|NDA1_ARATH Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial OS=Arabidopsis thaliana GN=NDA1 PE=2 SV=1 69 533 4.0E-76
sp|M0ZYF3|INDA1_SOLTU Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial OS=Solanum tuberosum GN=NDA1 PE=3 SV=1 69 533 6.0E-74
sp|O80874|NDA2_ARATH Internal alternative NAD(P)H-ubiquinone oxidoreductase A2, mitochondrial OS=Arabidopsis thaliana GN=NDA2 PE=2 SV=1 69 533 2.0E-73
sp|Q9ST63|NDA1_SOLTU Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial OS=Solanum tuberosum GN=NDA1 PE=1 SV=1 69 533 3.0E-73
sp|Q2YWP9|Y807_STAAB NADH dehydrogenase-like protein SAB0807 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB0807 PE=3 SV=1 69 423 1.0E-30
sp|Q5HHE4|Y944_STAAC NADH dehydrogenase-like protein SACOL0944 OS=Staphylococcus aureus (strain COL) GN=SACOL0944 PE=3 SV=1 69 423 1.0E-30
sp|Q99VE0|Y941_STAAM NADH dehydrogenase-like protein SAV0941 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV0941 PE=3 SV=1 69 423 1.0E-30
sp|Q6GIE7|Y903_STAAR NADH dehydrogenase-like protein SAR0903 OS=Staphylococcus aureus (strain MRSA252) GN=SAR0903 PE=3 SV=1 69 423 1.0E-30
sp|Q2FZV7|Y878_STAA8 NADH dehydrogenase-like protein SAOUHSC_00878 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_00878 PE=1 SV=1 69 423 1.0E-30
sp|Q2FID4|Y844_STAA3 NADH dehydrogenase-like protein SAUSA300_0844 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_0844 PE=3 SV=1 69 423 1.0E-30
sp|Q7A6J4|Y802_STAAN NADH dehydrogenase-like protein SA0802 OS=Staphylococcus aureus (strain N315) GN=SA0802 PE=1 SV=1 69 423 1.0E-30
sp|Q8NXG0|Y823_STAAW NADH dehydrogenase-like protein MW0823 OS=Staphylococcus aureus (strain MW2) GN=MW0823 PE=3 SV=1 69 423 1.0E-30
sp|Q6GAY5|Y811_STAAS NADH dehydrogenase-like protein SAS0811 OS=Staphylococcus aureus (strain MSSA476) GN=SAS0811 PE=3 SV=1 69 423 1.0E-30
sp|Q49W80|Y1834_STAS1 NADH dehydrogenase-like protein SSP1834 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1834 PE=3 SV=1 69 415 5.0E-29
sp|Q4L4V6|Y2010_STAHJ NADH dehydrogenase-like protein SH2010 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH2010 PE=3 SV=1 69 415 7.0E-29
sp|O05267|YUMB_BACSU NADH dehydrogenase-like protein YumB OS=Bacillus subtilis (strain 168) GN=yumB PE=3 SV=1 68 412 4.0E-28
sp|Q5HQM1|Y527_STAEQ NADH dehydrogenase-like protein SERP0527 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP0527 PE=3 SV=1 69 413 2.0E-27
sp|Q8CPV5|Y635_STAES NADH dehydrogenase-like protein SE_0635 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0635 PE=3 SV=1 69 413 2.0E-27
sp|P80861|YJLD_BACSU NADH dehydrogenase-like protein YjlD OS=Bacillus subtilis (strain 168) GN=yjlD PE=1 SV=3 70 409 1.0E-21
sp|P00393|DHNA_ECOLI NADH dehydrogenase OS=Escherichia coli (strain K12) GN=ndh PE=1 SV=2 95 403 6.0E-19
sp|P44856|DHNA_HAEIN NADH dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ndh PE=3 SV=1 95 403 9.0E-15
sp|O32117|YUTJ_BACSU NADH dehydrogenase-like protein YutJ OS=Bacillus subtilis (strain 168) GN=yutJ PE=3 SV=2 70 423 6.0E-14
sp|F4JJJ3|NDB3_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B3, mitochondrial OS=Arabidopsis thaliana GN=NDB3 PE=2 SV=1 352 533 8.0E-11
sp|Q1JPL4|NDB1_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Arabidopsis thaliana GN=NDB1 PE=1 SV=1 397 533 3.0E-10
sp|M1BYJ7|ENDB1_SOLTU External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Solanum tuberosum GN=NDB1 PE=3 SV=1 388 533 5.0E-10
sp|Q9ST62|NDB1_SOLTU External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Solanum tuberosum GN=NDB1 PE=1 SV=1 388 533 6.0E-10
sp|Q94BV7|NDB2_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial OS=Arabidopsis thaliana GN=NDB2 PE=1 SV=1 388 532 1.0E-09
sp|Q8GXR9|DHNA_ARATH Alternative NAD(P)H-ubiquinone oxidoreductase C1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=NDC1 PE=1 SV=2 59 449 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion|Endoplasmic reticulum 0.1689 0.1049 0.0691 0.0663 0.6608 0.0813 0.8154 0.2372 0.4589 0.1335

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 33 55 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5627
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4499
Ophiocordyceps australis map64 (Brazil) OphauB2|1093
Ophiocordyceps camponoti-floridani Ophcf2|01746
Ophiocordyceps camponoti-rufipedis Ophun1|2211
Ophiocordyceps kimflemingae Ophio5|4945
Ophiocordyceps subramaniannii Hirsu2|7717 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7717
MKLQTTDRIAFRRAYADEAPKPKPGKLRRALTWTWRLACLSVSGLFGYTLFVIYQDRHPEPQHEPDPSKKTLVIL
GTGWGSVALLKKLDTENYNVVVVSPRNYFLFTPLLPSCTTGTIEHRSIMEPVRAILRHKKAAAKFYEAEASSIDP
DRKVVRVVDSSEVRGATSETEIPYDMLVIGVGAENATFGIPGVREHSCFLKEIGDAQQIRKKIMDCVETAAFKGQ
SSDEVDRLMHMVVVGGGPTGVEFAGELQDFFEEDIKKLVPEISPRFKVTLIEALPNVLPSFSKQLIDYTENTLRE
EKIDIKTKTMVKKVTDKTVEAEASHPDGSKERVVIPYGLLVWATGNAVRSIVKDLMQRIPAQKDSRRGLAVNEYL
VVQGTRDIWAIGDCAIAGYAPTAQVASQEGNFLGRLFNNMAKTESHDQRIRELSSKLNLGAGNSAEAAEEIEKLE
RKLRKIKDIKPFRYTHQGSLAYIGSEKAVADVSWWNGNLATGGSMTYFFWRSAYLSMCFSTRNRVLVLLDWLKSK
AFGRDVSRE*
Coding >Hirsu2|7717
ATGAAGCTACAGACCACCGACCGCATCGCCTTCCGCAGAGCCTACGCCGACGAGGCTCCCAAACCAAAGCCGGGC
AAGCTGCGCAGGGCCTTGACATGGACATGGAGGCTAGCATGCCTCTCCGTCAGTGGCCTTTTCGGCTACACCCTC
TTCGTCATCTATCAGGATCGCCATCCCGAACCGCAGCACGAGCCCGACCCGAGCAAGAAGACGTTGGTCATACTA
GGAACCGGTTGGGGCTCCGTGGCCCTCCTGAAGAAGCTCGACACTGAGAACTACAACGTCGTCGTTGTTTCCCCG
CGCAATTATTTCCTCTTCACGCCTCTGCTTCCCTCGTGTACTACGGGCACCATCGAGCATCGATCCATCATGGAA
CCTGTCCGTGCTATCCTCCGCCACAAGAAGGCTGCCGCCAAGTTCTACGAAGCGGAGGCCTCCTCCATTGACCCT
GATCGCAAGGTCGTCAGGGTTGTGGATAGCTCCGAGGTCAGGGGCGCAACGTCGGAGACAGAAATTCCTTACGAC
ATGCTCGTCATCGGCGTCGGCGCTGAGAATGCAACCTTCGGCATCCCCGGCGTCAGAGAGCACAGCTGCTTTTTG
AAGGAGATAGGCGATGCCCAACAGATCCGGAAGAAGATCATGGATTGCGTCGAGACGGCCGCCTTCAAGGGCCAG
AGTAGTGACGAGGTCGACCGTCTGATGCACATGGTGGTGGTCGGCGGCGGTCCCACGGGTGTCGAGTTTGCCGGC
GAGCTCCAGGACTTCTTCGAGGAAGACATCAAGAAGTTGGTGCCCGAAATCAGCCCTCGCTTCAAGGTCACGCTC
ATCGAGGCACTGCCCAACGTACTGCCCTCTTTCTCGAAGCAGCTGATCGACTACACGGAAAACACCCTTCGCGAG
GAGAAGATTGACATCAAGACCAAGACCATGGTCAAGAAGGTCACAGACAAGACGGTCGAGGCCGAGGCGTCACAC
CCCGATGGCTCCAAGGAACGTGTCGTTATTCCCTACGGTCTGCTCGTATGGGCTACCGGCAATGCCGTCAGGTCC
ATTGTCAAAGACCTCATGCAGCGGATTCCCGCTCAGAAAGATTCCCGCCGCGGTCTCGCCGTCAACGAATATCTC
GTGGTTCAGGGAACGCGCGACATCTGGGCCATCGGCGACTGCGCCATTGCCGGGTATGCGCCTACCGCTCAGGTC
GCCTCCCAGGAGGGCAACTTCCTCGGCCGCCTCTTCAACAACATGGCCAAGACCGAGAGCCACGACCAACGCATC
CGGGAGCTGAGTAGCAAGCTGAATCTCGGAGCGGGGAACTCTGCTGAGGCAGCCGAGGAGATCGAGAAGCTGGAG
AGAAAGCTGCGCAAGATCAAGGACATCAAACCCTTCCGCTATACCCATCAGGGTAGTTTGGCCTACATCGGCAGC
GAGAAGGCTGTTGCCGACGTGAGCTGGTGGAATGGCAACTTGGCCACGGGCGGAAGCATGACGTACTTTTTCTGG
AGGAGCGCCTATTTGTCCATGTGCTTCAGCACTCGGAACAGAGTTTTGGTCCTGCTGGACTGGCTCAAGTCGAAG
GCTTTCGGCCGAGACGTGTCTCGTGAGTAA
Transcript >Hirsu2|7717
ATGAAGCTACAGACCACCGACCGCATCGCCTTCCGCAGAGCCTACGCCGACGAGGCTCCCAAACCAAAGCCGGGC
AAGCTGCGCAGGGCCTTGACATGGACATGGAGGCTAGCATGCCTCTCCGTCAGTGGCCTTTTCGGCTACACCCTC
TTCGTCATCTATCAGGATCGCCATCCCGAACCGCAGCACGAGCCCGACCCGAGCAAGAAGACGTTGGTCATACTA
GGAACCGGTTGGGGCTCCGTGGCCCTCCTGAAGAAGCTCGACACTGAGAACTACAACGTCGTCGTTGTTTCCCCG
CGCAATTATTTCCTCTTCACGCCTCTGCTTCCCTCGTGTACTACGGGCACCATCGAGCATCGATCCATCATGGAA
CCTGTCCGTGCTATCCTCCGCCACAAGAAGGCTGCCGCCAAGTTCTACGAAGCGGAGGCCTCCTCCATTGACCCT
GATCGCAAGGTCGTCAGGGTTGTGGATAGCTCCGAGGTCAGGGGCGCAACGTCGGAGACAGAAATTCCTTACGAC
ATGCTCGTCATCGGCGTCGGCGCTGAGAATGCAACCTTCGGCATCCCCGGCGTCAGAGAGCACAGCTGCTTTTTG
AAGGAGATAGGCGATGCCCAACAGATCCGGAAGAAGATCATGGATTGCGTCGAGACGGCCGCCTTCAAGGGCCAG
AGTAGTGACGAGGTCGACCGTCTGATGCACATGGTGGTGGTCGGCGGCGGTCCCACGGGTGTCGAGTTTGCCGGC
GAGCTCCAGGACTTCTTCGAGGAAGACATCAAGAAGTTGGTGCCCGAAATCAGCCCTCGCTTCAAGGTCACGCTC
ATCGAGGCACTGCCCAACGTACTGCCCTCTTTCTCGAAGCAGCTGATCGACTACACGGAAAACACCCTTCGCGAG
GAGAAGATTGACATCAAGACCAAGACCATGGTCAAGAAGGTCACAGACAAGACGGTCGAGGCCGAGGCGTCACAC
CCCGATGGCTCCAAGGAACGTGTCGTTATTCCCTACGGTCTGCTCGTATGGGCTACCGGCAATGCCGTCAGGTCC
ATTGTCAAAGACCTCATGCAGCGGATTCCCGCTCAGAAAGATTCCCGCCGCGGTCTCGCCGTCAACGAATATCTC
GTGGTTCAGGGAACGCGCGACATCTGGGCCATCGGCGACTGCGCCATTGCCGGGTATGCGCCTACCGCTCAGGTC
GCCTCCCAGGAGGGCAACTTCCTCGGCCGCCTCTTCAACAACATGGCCAAGACCGAGAGCCACGACCAACGCATC
CGGGAGCTGAGTAGCAAGCTGAATCTCGGAGCGGGGAACTCTGCTGAGGCAGCCGAGGAGATCGAGAAGCTGGAG
AGAAAGCTGCGCAAGATCAAGGACATCAAACCCTTCCGCTATACCCATCAGGGTAGTTTGGCCTACATCGGCAGC
GAGAAGGCTGTTGCCGACGTGAGCTGGTGGAATGGCAACTTGGCCACGGGCGGAAGCATGACGTACTTTTTCTGG
AGGAGCGCCTATTTGTCCATGTGCTTCAGCACTCGGAACAGAGTTTTGGTCCTGCTGGACTGGCTCAAGTCGAAG
GCTTTCGGCCGAGACGTGTCTCGTGAGTAA
Gene >Hirsu2|7717
ATGAAGCTACAGACCACCGACCGCATCGCCTTCCGCAGAGCCTACGCCGACGAGGCTCCCAAACCAAAGCCGGGC
AAGCTGCGCAGGGCCTTGACATGGACATGGAGGCTAGCATGCCTCTCCGTCAGTGGCCTTTTCGGCTACACCCTC
TTCGTCATCTATCAGGATCGCCATCCCGAACCGCAGCACGAGCCCGACCCGAGCAAGAAGACGTTGGTCATACTA
GGTGAGCAAAGGAACCATCTGCCCTCGTGTGCTGCGAATCACCATGCTCATCATTCACTAGGAACCGGTTGGGGC
TCCGTGGCCCTCCTGAAGAAGCTCGACACTGAGAACTACAACGTCGTCGTTGTTTCCCCGCGCAATTATTTCCTC
TTCACGCCTCTGCTTCCCTCGTGTACTACGGGCACCATCGAGCATCGATCCATCATGGAACCTGTCCGTGCTATC
CTCCGCCACAAGAAGGCTGCCGCCAAGTTCTACGAAGCGGAGGCCTCCTCCATTGACCCTGATCGCAAGGTCGTC
AGGGTTGTGGATAGCTCCGAGGTCAGGGGCGCAACGTCGGAGACAGAAATTCCTTACGACATGCTCGTCATCGGC
GTCGGCGCTGAGAATGCAACCTTCGGCATCCCCGGCGTCAGAGAGCACAGCTGCTTTTTGAAGGAGATAGGCGAT
GCCCAACAGATCCGGAAGAAGATCATGGATTGCGTCGAGACGGCCGCCTTCAAGGGCCAGAGTAGTGACGAGGTC
GACCGTCTGATGCACATGGTGGTGGTCGGCGGCGGTCCCACGGGTGTCGAGTTTGCCGGCGAGCTCCAGGACTTC
TTCGAGGAAGACATCAAGAAGTTGGTGCCCGAAATCAGCCCTCGCTTCAAGGTCACGCTCATCGAGGCACTGCCC
AACGTACTGCCCTCTTTCTCGAAGCAGCTGATCGACTACACGGAAAACACCCTTCGCGAGGAGAAGATTGACATC
AAGACCAAGACCATGGTCAAGAAGGTCACAGACAAGACGGTCGAGGCCGAGGCGTCACACCCCGATGGCTCCAAG
GAACGTGTCGTTATTCCCTACGGTCTGCTCGTATGGGCTACCGGCAATGCCGTCAGGTCCATTGTCAAAGACCTC
ATGCAGCGGATTCCCGCTCAGAAAGATTCCCGCCGCGGTCTCGCCGTCAACGAATATCTCGTGGTTCAGGGAACG
CGCGACATCTGGGCCATCGGCGACTGCGCCATTGCCGGGTATGCGCCTACCGCTCAGGTCGCCTCCCAGGAGGGC
AACTTCCTCGGCCGCCTCTTCAACAACATGGCCAAGACCGAGAGCCACGACCAACGCATCCGGGAGCTGAGTAGC
AAGCTGAATCTCGGAGCGGGGAACTCTGCTGAGGCAGCCGAGGAGATCGAGAAGCTGGAGAGAAAGCTGCGCAAG
ATCAAGGACATCAAACCCTTCCGCTATACCCATCAGGGTAGTTTGGCCTACATCGGCAGCGAGAAGGCTGTTGCC
GACGTGAGCTGGTGGAATGGCAACTTGGCCACGGGCGGAAGCATGACGTACTTTTTCTGGAGGAGCGCCTATTTG
TCCATGTGCTTCAGCAGTGAGTTTACTCTTTCCTCGCTCCTGGGGCATGCCGTTCGCGGATCCAGTTAGCTAACA
GCTCTGCAGCTCGGAACAGAGTTTTGGTCCTGCTGGACTGGCTCAAGTCGAAGGCTTTCGGCCGAGACGTGTCTC
GTGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail