Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7708
Gene name
LocationContig_463:15947..17957
Strand+
Gene length (bp)2010
Transcript length (bp)2010
Coding sequence length (bp)2010
Protein length (aa) 670

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05699 Dimer_Tnp_hAT hAT family C-terminal dimerisation region 7.3E-15 583 650

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P08770|TRA1_MAIZE Putative AC transposase OS=Zea mays PE=2 SV=2 124 652 3.0E-15
sp|P03010|TRAC9_MAIZE Putative AC9 transposase OS=Zea mays PE=4 SV=1 140 652 4.0E-14
sp|Q6AVI0|RSLE2_ORYSJ Zinc finger BED domain-containing protein RICESLEEPER 2 OS=Oryza sativa subsp. japonica GN=Os03g0733400 PE=2 SV=1 151 650 1.0E-09
sp|B9FJG3|RSLE1_ORYSJ Zinc finger BED domain-containing protein RICESLEEPER 1 OS=Oryza sativa subsp. japonica GN=Os05g0239150 PE=3 SV=1 151 650 1.0E-08
sp|Q80WQ9|ZBED4_MOUSE Zinc finger BED domain-containing protein 4 OS=Mus musculus GN=Zbed4 PE=2 SV=1 84 622 8.0E-06

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0005515 protein binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7708
MAAGWFPASAFDCLCADCHTKKRYFSQLFAAESTTAAIQHLVEFHKVKRPSVLANEDDGIEPNSTAEAFQLVMPF
NEDEYKQKLIDWVIKLRLSYREVADKATSELLTYGKPSLARLLPTHHSTLSQWVKDSLAARLPFIIGLVQSALSN
INLSIDGWRAHNRREYVAVCAHFVDGHGHPRTLLLGFPRRHGGHTGDDLAALVKPVILQYSIGEKFGSFVMDNAA
DNGKCLEALQRSFASIDPEADRIRCIGHIINLVVKALLFGEGVGAWEKKLIQASEEQPAALWSLKGVIGKLHNLV
SYINRNDARREVSRARMRVTKTSDGKLFVGVLLKDGGIRWNATYYMVERALKCRPAIDLYQAQWKCSDKNDKHRN
DFLTEADWHELELFYTLLQPFEQLTKRLQGRADGEGNEGGQGSVWQVLYAMDFLLTKLESVKEEIDIMDVDGDCA
LPPYYSCGVLAAWSKINTYYELTDQSPIYRMAIALHPAYQFEYFREKWWKREEWIKTAEKELTVYYDRFAAITVA
SENVDQAETSRSSSPTIDDEFDAWGHTTDRPHRGKRRKVETEWEMWIKQVPSKEDMNVKNPLAWWVDRRHVWPVH
SKLALNIFSAPAMSAEPERVFSDGSELITDKRNGLGDDTVEAEMIQKNWITSEIFRGVAIPQGLYKLPN*
Coding >Hirsu2|7708
ATGGCTGCTGGCTGGTTTCCTGCATCTGCATTCGACTGCCTCTGCGCCGATTGTCACACCAAGAAGCGGTATTTC
AGCCAGCTATTCGCGGCAGAATCGACGACAGCGGCAATCCAGCATCTTGTAGAGTTTCACAAGGTCAAGAGGCCT
TCGGTTTTAGCCAACGAGGACGACGGTATCGAGCCTAACAGCACCGCAGAAGCCTTCCAGCTCGTCATGCCATTC
AATGAGGACGAATATAAACAGAAGCTTATTGACTGGGTCATTAAGCTACGCCTCAGCTACCGAGAGGTCGCGGAC
AAGGCGACCAGTGAACTGCTCACATACGGCAAGCCTTCGCTCGCACGCCTGTTGCCAACGCATCACTCAACGCTC
TCGCAGTGGGTGAAGGATTCGTTGGCGGCACGCTTGCCGTTCATCATTGGACTGGTGCAGTCTGCGCTCAGTAAC
ATCAACCTGTCGATCGATGGATGGCGCGCCCATAATCGCCGAGAATACGTCGCTGTTTGCGCGCACTTCGTCGAC
GGCCACGGCCATCCTCGAACACTCCTCCTCGGCTTTCCACGACGACATGGCGGCCATACTGGCGATGACCTAGCA
GCGCTGGTCAAGCCAGTAATTCTGCAGTACAGCATCGGTGAGAAATTCGGTTCCTTCGTCATGGATAACGCTGCA
GATAACGGCAAATGTCTCGAGGCGTTACAGCGTTCCTTCGCCTCGATCGATCCAGAAGCAGACCGTATTCGCTGC
ATCGGTCATATTATTAATCTCGTCGTCAAAGCTCTCTTATTTGGCGAAGGCGTTGGTGCATGGGAGAAGAAACTT
ATTCAGGCTTCAGAGGAGCAGCCTGCAGCTCTCTGGAGTCTGAAAGGTGTCATTGGAAAGCTGCACAACCTCGTT
AGCTACATCAACCGCAACGACGCGCGTCGCGAGGTGTCGAGGGCTCGCATGCGCGTCACGAAGACGAGCGATGGC
AAGCTCTTCGTCGGCGTGCTCCTCAAAGACGGTGGCATTCGATGGAACGCAACATATTACATGGTCGAGCGTGCT
CTCAAGTGTCGCCCTGCTATCGATCTCTACCAGGCGCAGTGGAAGTGTTCAGATAAAAACGACAAGCACAGGAAT
GACTTCCTCACTGAGGCTGACTGGCACGAGCTTGAGCTCTTCTATACACTCTTGCAGCCCTTCGAGCAACTCACG
AAGCGACTGCAAGGCCGAGCAGACGGCGAGGGCAATGAAGGCGGCCAAGGCTCGGTGTGGCAAGTGCTCTATGCC
ATGGACTTCCTGCTCACGAAGCTTGAGAGTGTCAAAGAAGAGATTGACATCATGGATGTCGATGGCGACTGCGCC
CTTCCTCCCTATTACTCTTGCGGCGTGCTAGCTGCATGGTCAAAGATCAACACCTACTATGAGCTTACGGATCAA
TCGCCGATCTACCGTATGGCCATCGCCCTCCACCCAGCCTACCAATTCGAATACTTCAGAGAGAAGTGGTGGAAG
CGAGAGGAATGGATAAAGACAGCGGAGAAGGAGCTTACCGTATACTACGATCGCTTCGCTGCGATCACCGTAGCC
AGTGAGAACGTTGACCAAGCAGAGACCTCTCGTTCTTCCTCGCCGACGATTGATGACGAATTCGATGCTTGGGGC
CATACAACAGATCGACCACACCGTGGCAAGAGGAGAAAGGTGGAGACCGAGTGGGAGATGTGGATAAAGCAGGTG
CCTTCGAAGGAGGACATGAACGTCAAGAACCCCCTGGCGTGGTGGGTGGACCGACGCCACGTTTGGCCTGTTCAC
AGCAAGCTTGCTCTGAACATCTTCAGCGCGCCAGCAATGAGTGCGGAGCCGGAACGGGTATTTTCAGACGGTAGT
GAGCTCATTACCGACAAGCGCAACGGTCTCGGTGATGACACAGTTGAAGCTGAGATGATACAAAAGAATTGGATT
ACTTCGGAGATCTTTCGGGGGGTTGCTATACCGCAAGGTCTATACAAATTACCCAATTAG
Transcript >Hirsu2|7708
ATGGCTGCTGGCTGGTTTCCTGCATCTGCATTCGACTGCCTCTGCGCCGATTGTCACACCAAGAAGCGGTATTTC
AGCCAGCTATTCGCGGCAGAATCGACGACAGCGGCAATCCAGCATCTTGTAGAGTTTCACAAGGTCAAGAGGCCT
TCGGTTTTAGCCAACGAGGACGACGGTATCGAGCCTAACAGCACCGCAGAAGCCTTCCAGCTCGTCATGCCATTC
AATGAGGACGAATATAAACAGAAGCTTATTGACTGGGTCATTAAGCTACGCCTCAGCTACCGAGAGGTCGCGGAC
AAGGCGACCAGTGAACTGCTCACATACGGCAAGCCTTCGCTCGCACGCCTGTTGCCAACGCATCACTCAACGCTC
TCGCAGTGGGTGAAGGATTCGTTGGCGGCACGCTTGCCGTTCATCATTGGACTGGTGCAGTCTGCGCTCAGTAAC
ATCAACCTGTCGATCGATGGATGGCGCGCCCATAATCGCCGAGAATACGTCGCTGTTTGCGCGCACTTCGTCGAC
GGCCACGGCCATCCTCGAACACTCCTCCTCGGCTTTCCACGACGACATGGCGGCCATACTGGCGATGACCTAGCA
GCGCTGGTCAAGCCAGTAATTCTGCAGTACAGCATCGGTGAGAAATTCGGTTCCTTCGTCATGGATAACGCTGCA
GATAACGGCAAATGTCTCGAGGCGTTACAGCGTTCCTTCGCCTCGATCGATCCAGAAGCAGACCGTATTCGCTGC
ATCGGTCATATTATTAATCTCGTCGTCAAAGCTCTCTTATTTGGCGAAGGCGTTGGTGCATGGGAGAAGAAACTT
ATTCAGGCTTCAGAGGAGCAGCCTGCAGCTCTCTGGAGTCTGAAAGGTGTCATTGGAAAGCTGCACAACCTCGTT
AGCTACATCAACCGCAACGACGCGCGTCGCGAGGTGTCGAGGGCTCGCATGCGCGTCACGAAGACGAGCGATGGC
AAGCTCTTCGTCGGCGTGCTCCTCAAAGACGGTGGCATTCGATGGAACGCAACATATTACATGGTCGAGCGTGCT
CTCAAGTGTCGCCCTGCTATCGATCTCTACCAGGCGCAGTGGAAGTGTTCAGATAAAAACGACAAGCACAGGAAT
GACTTCCTCACTGAGGCTGACTGGCACGAGCTTGAGCTCTTCTATACACTCTTGCAGCCCTTCGAGCAACTCACG
AAGCGACTGCAAGGCCGAGCAGACGGCGAGGGCAATGAAGGCGGCCAAGGCTCGGTGTGGCAAGTGCTCTATGCC
ATGGACTTCCTGCTCACGAAGCTTGAGAGTGTCAAAGAAGAGATTGACATCATGGATGTCGATGGCGACTGCGCC
CTTCCTCCCTATTACTCTTGCGGCGTGCTAGCTGCATGGTCAAAGATCAACACCTACTATGAGCTTACGGATCAA
TCGCCGATCTACCGTATGGCCATCGCCCTCCACCCAGCCTACCAATTCGAATACTTCAGAGAGAAGTGGTGGAAG
CGAGAGGAATGGATAAAGACAGCGGAGAAGGAGCTTACCGTATACTACGATCGCTTCGCTGCGATCACCGTAGCC
AGTGAGAACGTTGACCAAGCAGAGACCTCTCGTTCTTCCTCGCCGACGATTGATGACGAATTCGATGCTTGGGGC
CATACAACAGATCGACCACACCGTGGCAAGAGGAGAAAGGTGGAGACCGAGTGGGAGATGTGGATAAAGCAGGTG
CCTTCGAAGGAGGACATGAACGTCAAGAACCCCCTGGCGTGGTGGGTGGACCGACGCCACGTTTGGCCTGTTCAC
AGCAAGCTTGCTCTGAACATCTTCAGCGCGCCAGCAATGAGTGCGGAGCCGGAACGGGTATTTTCAGACGGTAGT
GAGCTCATTACCGACAAGCGCAACGGTCTCGGTGATGACACAGTTGAAGCTGAGATGATACAAAAGAATTGGATT
ACTTCGGAGATCTTTCGGGGGGTTGCTATACCGCAAGGTCTATACAAATTACCCAATTAG
Gene >Hirsu2|7708
ATGGCTGCTGGCTGGTTTCCTGCATCTGCATTCGACTGCCTCTGCGCCGATTGTCACACCAAGAAGCGGTATTTC
AGCCAGCTATTCGCGGCAGAATCGACGACAGCGGCAATCCAGCATCTTGTAGAGTTTCACAAGGTCAAGAGGCCT
TCGGTTTTAGCCAACGAGGACGACGGTATCGAGCCTAACAGCACCGCAGAAGCCTTCCAGCTCGTCATGCCATTC
AATGAGGACGAATATAAACAGAAGCTTATTGACTGGGTCATTAAGCTACGCCTCAGCTACCGAGAGGTCGCGGAC
AAGGCGACCAGTGAACTGCTCACATACGGCAAGCCTTCGCTCGCACGCCTGTTGCCAACGCATCACTCAACGCTC
TCGCAGTGGGTGAAGGATTCGTTGGCGGCACGCTTGCCGTTCATCATTGGACTGGTGCAGTCTGCGCTCAGTAAC
ATCAACCTGTCGATCGATGGATGGCGCGCCCATAATCGCCGAGAATACGTCGCTGTTTGCGCGCACTTCGTCGAC
GGCCACGGCCATCCTCGAACACTCCTCCTCGGCTTTCCACGACGACATGGCGGCCATACTGGCGATGACCTAGCA
GCGCTGGTCAAGCCAGTAATTCTGCAGTACAGCATCGGTGAGAAATTCGGTTCCTTCGTCATGGATAACGCTGCA
GATAACGGCAAATGTCTCGAGGCGTTACAGCGTTCCTTCGCCTCGATCGATCCAGAAGCAGACCGTATTCGCTGC
ATCGGTCATATTATTAATCTCGTCGTCAAAGCTCTCTTATTTGGCGAAGGCGTTGGTGCATGGGAGAAGAAACTT
ATTCAGGCTTCAGAGGAGCAGCCTGCAGCTCTCTGGAGTCTGAAAGGTGTCATTGGAAAGCTGCACAACCTCGTT
AGCTACATCAACCGCAACGACGCGCGTCGCGAGGTGTCGAGGGCTCGCATGCGCGTCACGAAGACGAGCGATGGC
AAGCTCTTCGTCGGCGTGCTCCTCAAAGACGGTGGCATTCGATGGAACGCAACATATTACATGGTCGAGCGTGCT
CTCAAGTGTCGCCCTGCTATCGATCTCTACCAGGCGCAGTGGAAGTGTTCAGATAAAAACGACAAGCACAGGAAT
GACTTCCTCACTGAGGCTGACTGGCACGAGCTTGAGCTCTTCTATACACTCTTGCAGCCCTTCGAGCAACTCACG
AAGCGACTGCAAGGCCGAGCAGACGGCGAGGGCAATGAAGGCGGCCAAGGCTCGGTGTGGCAAGTGCTCTATGCC
ATGGACTTCCTGCTCACGAAGCTTGAGAGTGTCAAAGAAGAGATTGACATCATGGATGTCGATGGCGACTGCGCC
CTTCCTCCCTATTACTCTTGCGGCGTGCTAGCTGCATGGTCAAAGATCAACACCTACTATGAGCTTACGGATCAA
TCGCCGATCTACCGTATGGCCATCGCCCTCCACCCAGCCTACCAATTCGAATACTTCAGAGAGAAGTGGTGGAAG
CGAGAGGAATGGATAAAGACAGCGGAGAAGGAGCTTACCGTATACTACGATCGCTTCGCTGCGATCACCGTAGCC
AGTGAGAACGTTGACCAAGCAGAGACCTCTCGTTCTTCCTCGCCGACGATTGATGACGAATTCGATGCTTGGGGC
CATACAACAGATCGACCACACCGTGGCAAGAGGAGAAAGGTGGAGACCGAGTGGGAGATGTGGATAAAGCAGGTG
CCTTCGAAGGAGGACATGAACGTCAAGAACCCCCTGGCGTGGTGGGTGGACCGACGCCACGTTTGGCCTGTTCAC
AGCAAGCTTGCTCTGAACATCTTCAGCGCGCCAGCAATGAGTGCGGAGCCGGAACGGGTATTTTCAGACGGTAGT
GAGCTCATTACCGACAAGCGCAACGGTCTCGGTGATGACACAGTTGAAGCTGAGATGATACAAAAGAATTGGATT
ACTTCGGAGATCTTTCGGGGGGTTGCTATACCGCAAGGTCTATACAAATTACCCAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail