Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7707
Gene name
LocationContig_463:14739..15573
Strand+
Gene length (bp)834
Transcript length (bp)756
Coding sequence length (bp)756
Protein length (aa) 252

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase) 1.0E-25 76 238

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P21329|RTJK_DROFU RNA-directed DNA polymerase from mobile element jockey OS=Drosophila funebris GN=jockeypol PE=1 SV=1 26 235 1.0E-14
sp|Q9NBX4|RTXE_DROME Probable RNA-directed DNA polymerase from transposon X-element OS=Drosophila melanogaster GN=X-elementORF2 PE=3 SV=1 17 237 4.0E-11
sp|P21328|RTJK_DROME RNA-directed DNA polymerase from mobile element jockey OS=Drosophila melanogaster GN=pol PE=1 SV=1 15 235 4.0E-11
sp|Q03274|PO22_POPJA Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 (Fragment) OS=Popillia japonica PE=3 SV=1 42 235 2.0E-10
sp|Q95SX7|RTBS_DROME Probable RNA-directed DNA polymerase from transposon BS OS=Drosophila melanogaster GN=RTase PE=2 SV=1 26 235 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P21329|RTJK_DROFU RNA-directed DNA polymerase from mobile element jockey OS=Drosophila funebris GN=jockeypol PE=1 SV=1 26 235 1.0E-14
sp|Q9NBX4|RTXE_DROME Probable RNA-directed DNA polymerase from transposon X-element OS=Drosophila melanogaster GN=X-elementORF2 PE=3 SV=1 17 237 4.0E-11
sp|P21328|RTJK_DROME RNA-directed DNA polymerase from mobile element jockey OS=Drosophila melanogaster GN=pol PE=1 SV=1 15 235 4.0E-11
sp|Q03274|PO22_POPJA Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 (Fragment) OS=Popillia japonica PE=3 SV=1 42 235 2.0E-10
sp|Q95SX7|RTBS_DROME Probable RNA-directed DNA polymerase from transposon BS OS=Drosophila melanogaster GN=RTase PE=2 SV=1 26 235 2.0E-08
sp|O00370|LORF2_HUMAN LINE-1 retrotransposable element ORF2 protein OS=Homo sapiens PE=1 SV=1 70 243 2.0E-07
sp|P16425|Y2R2_DROME Putative 115 kDa protein in type-1 retrotransposable element R1DM OS=Drosophila melanogaster GN=R1A1-elementORF2 PE=3 SV=1 7 218 2.0E-07
sp|P16423|POLR_DROME Retrovirus-related Pol polyprotein from type-2 retrotransposable element R2DM OS=Drosophila melanogaster GN=pol PE=3 SV=1 89 246 3.0E-07
sp|P08548|LIN1_NYCCO LINE-1 reverse transcriptase homolog OS=Nycticebus coucang PE=3 SV=1 25 228 1.0E-06
sp|P11369|LORF2_MOUSE LINE-1 retrotransposable element ORF2 protein OS=Mus musculus GN=Pol PE=1 SV=2 36 228 2.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2338 0.3789 0.6204 0.1137 0.2069 0.2596 0.2107 0.0841 0.2749 0.0539

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup369
Change Orthofinder run
Species Protein ID
Ophiocordyceps kimflemingae Ophio5|941
Ophiocordyceps subramaniannii Hirsu2|10220
Ophiocordyceps subramaniannii Hirsu2|1656
Ophiocordyceps subramaniannii Hirsu2|552
Ophiocordyceps subramaniannii Hirsu2|7707 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7736
Ophiocordyceps subramaniannii Hirsu2|8187
Ophiocordyceps subramaniannii Hirsu2|84
Ophiocordyceps subramaniannii Hirsu2|8425
Ophiocordyceps subramaniannii Hirsu2|8428

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7707
MWSKYWILSTFFPPLPEKIENEGARPQRKAVPMPDLTLEEIEEKVIAAKPWKAPGDDGLPAMVWKQLWPAIIPLK
KPDKGDYKVAKRRRPISLLSTLGKTLEAVVAERISYAVEVYGLLPANHFGARKWRSAEQALLLLQKQVYKAWRNR
NVLSLISFDVKGAYNGVYKERLLERMKARGIPDRLVRWMDAFFSGRTASVVVNGHTSEQRELPQAGLSQGSPLSP
VSFLFFNADLVQRKIKAEAGSIAFRV*
Coding >Hirsu2|7707
ATGTGGAGCAAATACTGGATCCTCAGCACCTTCTTCCCTCCCTTGCCTGAGAAAATCGAGAATGAAGGAGCGCGA
CCACAGCGGAAAGCGGTGCCCATGCCCGACTTGACCCTGGAAGAGATCGAGGAAAAGGTCATAGCAGCGAAACCG
TGGAAAGCACCCGGAGATGATGGACTCCCGGCGATGGTGTGGAAACAACTCTGGCCGGCGATCATCCCGCTGAAG
AAGCCGGACAAGGGAGACTACAAGGTGGCGAAACGGAGGCGACCGATATCGCTTCTGTCGACACTTGGCAAAACA
CTAGAAGCGGTCGTTGCAGAGCGCATATCCTACGCGGTAGAGGTTTACGGGCTCCTGCCGGCAAACCATTTCGGA
GCGAGAAAGTGGCGGTCTGCCGAGCAAGCGCTCCTGCTCCTTCAGAAACAAGTTTACAAGGCCTGGCGAAATCGC
AATGTGCTCAGCCTGATCAGTTTCGATGTAAAAGGCGCCTACAATGGAGTGTACAAAGAGCGACTACTGGAGAGA
ATGAAGGCGAGAGGAATACCAGACAGGTTGGTAAGGTGGATGGATGCCTTCTTTTCCGGGCGAACAGCCTCGGTG
GTGGTGAATGGGCACACGTCCGAACAGAGGGAGTTGCCTCAGGCAGGTCTCTCCCAAGGATCGCCGTTGTCACCG
GTCTCGTTCCTCTTCTTCAACGCAGACTTGGTGCAGAGAAAGATCAAGGCGGAAGCCGGCTCGATTGCATTCCGT
GTATGA
Transcript >Hirsu2|7707
ATGTGGAGCAAATACTGGATCCTCAGCACCTTCTTCCCTCCCTTGCCTGAGAAAATCGAGAATGAAGGAGCGCGA
CCACAGCGGAAAGCGGTGCCCATGCCCGACTTGACCCTGGAAGAGATCGAGGAAAAGGTCATAGCAGCGAAACCG
TGGAAAGCACCCGGAGATGATGGACTCCCGGCGATGGTGTGGAAACAACTCTGGCCGGCGATCATCCCGCTGAAG
AAGCCGGACAAGGGAGACTACAAGGTGGCGAAACGGAGGCGACCGATATCGCTTCTGTCGACACTTGGCAAAACA
CTAGAAGCGGTCGTTGCAGAGCGCATATCCTACGCGGTAGAGGTTTACGGGCTCCTGCCGGCAAACCATTTCGGA
GCGAGAAAGTGGCGGTCTGCCGAGCAAGCGCTCCTGCTCCTTCAGAAACAAGTTTACAAGGCCTGGCGAAATCGC
AATGTGCTCAGCCTGATCAGTTTCGATGTAAAAGGCGCCTACAATGGAGTGTACAAAGAGCGACTACTGGAGAGA
ATGAAGGCGAGAGGAATACCAGACAGGTTGGTAAGGTGGATGGATGCCTTCTTTTCCGGGCGAACAGCCTCGGTG
GTGGTGAATGGGCACACGTCCGAACAGAGGGAGTTGCCTCAGGCAGGTCTCTCCCAAGGATCGCCGTTGTCACCG
GTCTCGTTCCTCTTCTTCAACGCAGACTTGGTGCAGAGAAAGATCAAGGCGGAAGCCGGCTCGATTGCATTCCGT
GTATGA
Gene >Hirsu2|7707
ATGTGGAGCAAATACTGGATCCTCAGCACCTTCTTCCCTCCCTTGCCTGAGAAAATCGAGAATGAAGGAGCGCGA
CCACAGCGGAAAGCGGTGCCCATGCCCGACTTGACCCTGGAAGAGATCGAGGAAAAGGTCATAGCAGCGAAACCG
TGGAAAGCACCCGGAGATGATGGACTCCCGGCGATGGTGTGGAAACAACTCTGGCCGGCGGTAAAGCACCGGAGG
CTGGCTCTCTTTGATGTGTGACTCAGAGACGGCGTAGTGCCTCGACAATGGAGAAGTGCCAAGATCATCCCGCTG
AAGAAGCCGGACAAGGGAGACTACAAGGTGGCGAAACGGAGGCGACCGATATCGCTTCTGTCGACACTTGGCAAA
ACACTAGAAGCGGTCGTTGCAGAGCGCATATCCTACGCGGTAGAGGTTTACGGGCTCCTGCCGGCAAACCATTTC
GGAGCGAGAAAGTGGCGGTCTGCCGAGCAAGCGCTCCTGCTCCTTCAGAAACAAGTTTACAAGGCCTGGCGAAAT
CGCAATGTGCTCAGCCTGATCAGTTTCGATGTAAAAGGCGCCTACAATGGAGTGTACAAAGAGCGACTACTGGAG
AGAATGAAGGCGAGAGGAATACCAGACAGGTTGGTAAGGTGGATGGATGCCTTCTTTTCCGGGCGAACAGCCTCG
GTGGTGGTGAATGGGCACACGTCCGAACAGAGGGAGTTGCCTCAGGCAGGTCTCTCCCAAGGATCGCCGTTGTCA
CCGGTCTCGTTCCTCTTCTTCAACGCAGACTTGGTGCAGAGAAAGATCAAGGCGGAAGCCGGCTCGATTGCATTC
CGTGTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail