Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7705
Gene name
LocationContig_463:3420..5320
Strand-
Gene length (bp)1900
Transcript length (bp)1734
Coding sequence length (bp)1734
Protein length (aa) 578

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04146 YTH YT521-B-like domain 5.0E-61 351 544

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A9LNK9|CPSF_ARATH 30-kDa cleavage and polyadenylation specificity factor 30 OS=Arabidopsis thaliana GN=CPSF30 PE=1 SV=1 350 543 2.0E-17
sp|Q0DA50|C3H45_ORYSJ Zinc finger CCCH domain-containing protein 45 OS=Oryza sativa subsp. japonica GN=Os06g0677700 PE=3 SV=1 352 414 1.0E-11
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 473 554 1.0E-10
sp|Q5R746|YTDC2_PONAB YTH domain-containing protein 2 OS=Pongo abelii GN=YTHDC2 PE=2 SV=1 473 549 2.0E-10
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 473 549 4.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A9LNK9|CPSF_ARATH 30-kDa cleavage and polyadenylation specificity factor 30 OS=Arabidopsis thaliana GN=CPSF30 PE=1 SV=1 350 543 2.0E-17
sp|Q0DA50|C3H45_ORYSJ Zinc finger CCCH domain-containing protein 45 OS=Oryza sativa subsp. japonica GN=Os06g0677700 PE=3 SV=1 352 414 1.0E-11
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 473 554 1.0E-10
sp|Q5R746|YTDC2_PONAB YTH domain-containing protein 2 OS=Pongo abelii GN=YTHDC2 PE=2 SV=1 473 549 2.0E-10
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 473 549 4.0E-10
sp|Q0DA50|C3H45_ORYSJ Zinc finger CCCH domain-containing protein 45 OS=Oryza sativa subsp. japonica GN=Os06g0677700 PE=3 SV=1 486 543 4.0E-08
sp|Q5R746|YTDC2_PONAB YTH domain-containing protein 2 OS=Pongo abelii GN=YTHDC2 PE=2 SV=1 352 414 2.0E-07
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 352 414 4.0E-07
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 352 414 5.0E-07
sp|Q96MU7|YTDC1_HUMAN YTH domain-containing protein 1 OS=Homo sapiens GN=YTHDC1 PE=1 SV=3 327 413 1.0E-06
sp|Q9QY02|YTDC1_RAT YTH domain-containing protein 1 OS=Rattus norvegicus GN=Ythdc1 PE=1 SV=2 327 413 1.0E-06
sp|E9Q5K9|YTDC1_MOUSE YTH domain-containing protein 1 OS=Mus musculus GN=Ythdc1 PE=1 SV=2 327 413 1.0E-06
sp|Q96MU7|YTDC1_HUMAN YTH domain-containing protein 1 OS=Homo sapiens GN=YTHDC1 PE=1 SV=3 488 543 2.0E-06
sp|Q9QY02|YTDC1_RAT YTH domain-containing protein 1 OS=Rattus norvegicus GN=Ythdc1 PE=1 SV=2 488 543 2.0E-06
sp|E9Q5K9|YTDC1_MOUSE YTH domain-containing protein 1 OS=Mus musculus GN=Ythdc1 PE=1 SV=2 488 543 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.7387 0.5007 0.0955 0.0349 0.0748 0.0046 0.146 0.1165 0.1146 0.0497

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup407
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7438
Ophiocordyceps australis map64 (Brazil) OphauB2|7806
Ophiocordyceps camponoti-floridani Ophcf2|07380
Ophiocordyceps camponoti-rufipedis Ophun1|3210
Ophiocordyceps kimflemingae Ophio5|5140
Ophiocordyceps subramaniannii Hirsu2|2237
Ophiocordyceps subramaniannii Hirsu2|7705 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8182
Ophiocordyceps subramaniannii Hirsu2|8426

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7705
MQKNASGPPQPQGIASNAFSAPLVLASSDAFYDQQQSYGMTPMDNALLIVDYQSTQYSQPAQLYLPATSLPVIQQ
IPYNFPHGDPLPGMGQGFYVPQPQMPYYYTPGRIPSGQGPMPTSQNLVYYPNQMINHHPQPGLYYAQTNHIPRQS
QNMPLRPGQYVPSRLASFDAQKPHPLVDCPGMPVSAQKQACQEALSSRQTKIRGPPRKARQSGHAIWIGNLPRQT
DLMVLAHHICKETIGLESLFLISKSKCAFANFKDENTCLAAQRKLHKSKFQSVILVSRLRKKNLEKANGLAATPG
PATSHVGAAAAYDDSAQHNPAPGAFCLSLTASQATKPKTSPCVKESGQNDTFFILKSLTTEDLELSVQTGIWATQ
SHNEEALNNALKSCNNVYLILSANKSHEYFGYARMLSEVNDDPAAAIELSPNSLDSPRVIPVDATKHVPKGRIVD
DSVRGTIFWEAEREDAVSESDNMSEASTKSGGTEDGTKPWGKPFKLEWLSISRLPFYQTQGLRNPWNSNREVKIA
RDGTELEPSVGRRLIGLFNRVQTGGPASSAMHPHLPMIHGCVKLTGSRSMHR*
Coding >Hirsu2|7705
ATGCAAAAAAATGCCTCAGGGCCTCCGCAACCACAAGGGATTGCGAGCAATGCGTTTTCCGCGCCGCTCGTCCTG
GCCTCCTCAGACGCCTTCTACGACCAACAACAGTCCTATGGAATGACCCCAATGGATAACGCTCTGCTCATTGTT
GACTACCAGTCCACCCAGTACTCGCAACCAGCCCAACTGTATCTCCCGGCTACCTCGCTCCCTGTGATCCAGCAG
ATACCGTACAATTTCCCGCACGGGGATCCTCTCCCAGGCATGGGCCAAGGCTTCTATGTCCCTCAGCCTCAGATG
CCCTATTACTATACGCCCGGCCGCATACCCTCCGGGCAAGGACCGATGCCTACCAGTCAGAATCTCGTGTACTAC
CCGAACCAGATGATAAATCATCACCCGCAACCCGGCCTGTATTACGCCCAGACTAACCACATTCCTCGGCAATCG
CAGAACATGCCGCTGAGACCGGGCCAGTATGTGCCAAGCAGGCTTGCAAGCTTTGATGCTCAAAAGCCTCATCCT
CTGGTAGACTGCCCGGGGATGCCAGTTTCAGCTCAAAAGCAAGCTTGTCAAGAAGCATTGAGCAGCCGACAGACC
AAAATTCGAGGACCTCCACGGAAGGCTCGCCAAAGTGGACATGCCATCTGGATCGGGAATTTGCCTCGGCAGACC
GACCTGATGGTCTTGGCTCACCACATTTGCAAGGAGACAATTGGACTGGAGTCCCTATTCCTTATCTCGAAAAGC
AAATGTGCGTTTGCAAATTTTAAAGACGAAAACACTTGCCTGGCGGCCCAACGGAAACTGCACAAATCCAAGTTC
CAATCCGTGATTCTCGTCAGTCGCCTGCGAAAGAAGAACCTGGAAAAAGCCAATGGTTTGGCGGCCACCCCCGGC
CCGGCAACCAGTCACGTGGGTGCCGCCGCGGCCTATGACGACTCAGCTCAACATAATCCGGCCCCGGGGGCCTTT
TGCCTGAGTTTGACAGCCAGCCAGGCAACAAAACCCAAGACGAGTCCATGCGTCAAAGAAAGCGGCCAGAACGAC
ACTTTTTTCATCCTCAAGAGCCTTACGACGGAAGATCTCGAACTGAGCGTGCAAACTGGGATCTGGGCCACACAG
TCACATAATGAAGAGGCGCTCAACAACGCCTTGAAGAGCTGTAATAATGTGTATCTAATTTTGTCGGCGAACAAA
TCGCACGAATACTTTGGGTACGCTCGCATGCTATCAGAGGTCAATGACGATCCGGCGGCGGCGATAGAACTTTCG
CCGAACTCCCTTGACTCACCACGGGTGATTCCTGTCGACGCAACAAAACATGTTCCCAAGGGCAGGATCGTTGAT
GATTCTGTCAGAGGAACAATCTTCTGGGAAGCCGAACGAGAGGATGCGGTGAGCGAATCCGATAACATGAGTGAG
GCTTCCACAAAGAGCGGCGGGACGGAGGATGGAACGAAACCTTGGGGGAAACCATTTAAGCTTGAATGGCTGTCG
ATCAGTCGACTGCCTTTCTATCAGACCCAAGGATTAAGAAACCCATGGAATTCAAATAGGGAGGTCAAGATCGCA
AGAGACGGAACTGAGCTGGAGCCCTCAGTCGGCCGCAGACTTATTGGACTCTTCAACCGTGTGCAGACTGGCGGG
CCTGCGTCATCGGCGATGCACCCGCACCTGCCGATGATACACGGCTGTGTAAAGCTCACCGGCTCAAGAAGTATG
CATCGATGA
Transcript >Hirsu2|7705
ATGCAAAAAAATGCCTCAGGGCCTCCGCAACCACAAGGGATTGCGAGCAATGCGTTTTCCGCGCCGCTCGTCCTG
GCCTCCTCAGACGCCTTCTACGACCAACAACAGTCCTATGGAATGACCCCAATGGATAACGCTCTGCTCATTGTT
GACTACCAGTCCACCCAGTACTCGCAACCAGCCCAACTGTATCTCCCGGCTACCTCGCTCCCTGTGATCCAGCAG
ATACCGTACAATTTCCCGCACGGGGATCCTCTCCCAGGCATGGGCCAAGGCTTCTATGTCCCTCAGCCTCAGATG
CCCTATTACTATACGCCCGGCCGCATACCCTCCGGGCAAGGACCGATGCCTACCAGTCAGAATCTCGTGTACTAC
CCGAACCAGATGATAAATCATCACCCGCAACCCGGCCTGTATTACGCCCAGACTAACCACATTCCTCGGCAATCG
CAGAACATGCCGCTGAGACCGGGCCAGTATGTGCCAAGCAGGCTTGCAAGCTTTGATGCTCAAAAGCCTCATCCT
CTGGTAGACTGCCCGGGGATGCCAGTTTCAGCTCAAAAGCAAGCTTGTCAAGAAGCATTGAGCAGCCGACAGACC
AAAATTCGAGGACCTCCACGGAAGGCTCGCCAAAGTGGACATGCCATCTGGATCGGGAATTTGCCTCGGCAGACC
GACCTGATGGTCTTGGCTCACCACATTTGCAAGGAGACAATTGGACTGGAGTCCCTATTCCTTATCTCGAAAAGC
AAATGTGCGTTTGCAAATTTTAAAGACGAAAACACTTGCCTGGCGGCCCAACGGAAACTGCACAAATCCAAGTTC
CAATCCGTGATTCTCGTCAGTCGCCTGCGAAAGAAGAACCTGGAAAAAGCCAATGGTTTGGCGGCCACCCCCGGC
CCGGCAACCAGTCACGTGGGTGCCGCCGCGGCCTATGACGACTCAGCTCAACATAATCCGGCCCCGGGGGCCTTT
TGCCTGAGTTTGACAGCCAGCCAGGCAACAAAACCCAAGACGAGTCCATGCGTCAAAGAAAGCGGCCAGAACGAC
ACTTTTTTCATCCTCAAGAGCCTTACGACGGAAGATCTCGAACTGAGCGTGCAAACTGGGATCTGGGCCACACAG
TCACATAATGAAGAGGCGCTCAACAACGCCTTGAAGAGCTGTAATAATGTGTATCTAATTTTGTCGGCGAACAAA
TCGCACGAATACTTTGGGTACGCTCGCATGCTATCAGAGGTCAATGACGATCCGGCGGCGGCGATAGAACTTTCG
CCGAACTCCCTTGACTCACCACGGGTGATTCCTGTCGACGCAACAAAACATGTTCCCAAGGGCAGGATCGTTGAT
GATTCTGTCAGAGGAACAATCTTCTGGGAAGCCGAACGAGAGGATGCGGTGAGCGAATCCGATAACATGAGTGAG
GCTTCCACAAAGAGCGGCGGGACGGAGGATGGAACGAAACCTTGGGGGAAACCATTTAAGCTTGAATGGCTGTCG
ATCAGTCGACTGCCTTTCTATCAGACCCAAGGATTAAGAAACCCATGGAATTCAAATAGGGAGGTCAAGATCGCA
AGAGACGGAACTGAGCTGGAGCCCTCAGTCGGCCGCAGACTTATTGGACTCTTCAACCGTGTGCAGACTGGCGGG
CCTGCGTCATCGGCGATGCACCCGCACCTGCCGATGATACACGGCTGTGTAAAGCTCACCGGCTCAAGAAGTATG
CATCGATGA
Gene >Hirsu2|7705
ATGCAAAAAAATGCCTCAGGGCCTCCGCAACCACAAGGGATTGCGAGCAATGCGTTTTCCGCGCCGCTCGTCCTG
GCCTCCTCAGACGCCTTCTACGACCAACAACAGTCCTATGGAATGACCCCAATGGATAACGCTCTGCTCATTGTT
GACTACCAGTCCACCCAGTACTCGCAACCAGCCCAACTGTATCTCCCGGCTACCTCGCTCCCTGTGATCCAGCAG
ATACCGTACAATTTCCCGCACGGGGATCCTCTCCCAGGCATGGGCCAAGGCTTCTATGTCCCTCAGCCTCAGATG
CCCTATTACTATACGCCCGGCCGCATACCCTCCGGGCAAGGACCGATGCCTACCAGTCAGAATCTCGTGTACTAC
CCGAACCAGATGATAAATCATCACCCGCAACCCGGCCTGTATTACGCCCAGACTAACCACATTCCTCGGCAATCG
CAGAACATGCCGCTGAGACCGGGCCAGTATGTGCCAAGCAGGCTTGCAAGCTTTGATGCTCAAAAGCCTCATCCT
CTGGTAGACTGCCCGGGGATGCCAGTTTCAGCTCAAAAGCAAGCTTGTCAAGGTATGGGCTCTAGGAGGGACTGC
CAGGTGACTTCCCGCGGAGTCTGACTTTGCCGCAGAAGCATTGAGCAGCCGACAGACCAAAATTCGAGGACCTCC
ACGGAAGGCTCGCCAAAGTGGTAAGAAGGCACATTTCGCAATTCAGGCCGATGCGGTTTGGGTGGCTGATCTTGC
CCAGGACATGCCATCTGGATCGGGAATTTGCCTCGGCAGACCGACCTGATGGTCTTGGCTCACCACATTTGCAAG
GAGACAATTGGACTGGAGTCCCTATTCCTTATCTCGAAAAGCAAATGTGCGTTTGCAAATTTTAAAGACGAAAAC
ACTTGCCTGGCGGCCCAACGGAAACTGCACAAATCCAAGTTCCAATCCGTGATTCTCGTCAGTCGCCTGCGAAAG
AAGAACCTGGAAAAAGCCAATGGTTTGGCGGCCACCCCCGGCCCGGCAACCAGTCACGTGGGTGCCGCCGCGGCC
TATGACGACTCAGCTCAACATAATCCGGCCCCGGGGGCCTTTTGCCTGAGTTTGACAGCCAGCCAGGCAACAAAA
CCCAAGACGAGTCCATGCGTCAAAGAAAGCGGCCAGAACGACACTTTTTTCATCCTCAAGAGCCTTACGACGGAA
GATCTCGAACTGAGCGTGCAAACTGGGATCTGGGCCACACAGTCACATAATGAAGAGGCGCTCAACAACGCCTTG
AAGGTTAGTACACCCGGACGGAGACTTGTCCGCACGTAGCTAACTTGAAAAGAGCTGTAATAATGTGTATCTAAT
TTTGTCGGCGAACAAATCGCACGAATACTTTGGGTACGCTCGCATGCTATCAGAGGTCAATGACGATCCGGCGGC
GGCGATAGAACTTTCGCCGAACTCCCTTGACTCACCACGGGTGATTCCTGTCGACGCAACAAAACATGTTCCCAA
GGGCAGGATCGTTGATGATTCTGTCAGAGGAACAATCTTCTGGGAAGCCGAACGAGAGGATGCGGTGAGCGAATC
CGATAACATGAGTGAGGCTTCCACAAAGAGCGGCGGGACGGAGGATGGAACGAAACCTTGGGGGAAACCATTTAA
GCTTGAATGGCTGTCGATCAGTCGACTGCCTTTCTATCAGACCCAAGGATTAAGAAACCCATGGAATTCAAATAG
GGAGGTCAAGATCGCAAGAGACGGAACTGAGCTGGAGCCCTCAGTCGGCCGCAGACTTATTGGACTCTTCAACCG
TGTGCAGACTGGCGGGCCTGCGTCATCGGCGATGCACCCGCACCTGCCGATGATACACGGCTGTGTAAAGCTCAC
CGGCTCAAGAAGTATGCATCGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail