Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7703
Gene name
LocationContig_462:14148..14984
Strand+
Gene length (bp)836
Transcript length (bp)780
Coding sequence length (bp)780
Protein length (aa) 260

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00136 DNA_pol_B DNA polymerase family B 1.1E-24 8 122
PF14260 zf-C4pol C4-type zinc-finger of DNA polymerase delta 1.3E-17 160 234

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P30316|DPOD_SCHPO DNA polymerase delta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol3 PE=1 SV=2 2 252 1.0E-111
sp|P46588|DPOD_CANAX DNA polymerase delta catalytic subunit OS=Candida albicans GN=POL3 PE=3 SV=2 1 252 2.0E-106
sp|Q9LRE6|DPOD1_ORYSJ DNA polymerase delta catalytic subunit OS=Oryza sativa subsp. japonica GN=POLD1 PE=2 SV=1 2 252 5.0E-99
sp|Q9LVN7|DPOD1_ARATH DNA polymerase delta catalytic subunit OS=Arabidopsis thaliana GN=POLD1 PE=2 SV=2 2 251 2.0E-96
sp|P28339|DPOD1_BOVIN DNA polymerase delta catalytic subunit OS=Bos taurus GN=POLD1 PE=1 SV=1 2 259 1.0E-95
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P30316|DPOD_SCHPO DNA polymerase delta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol3 PE=1 SV=2 2 252 1.0E-111
sp|P46588|DPOD_CANAX DNA polymerase delta catalytic subunit OS=Candida albicans GN=POL3 PE=3 SV=2 1 252 2.0E-106
sp|Q9LRE6|DPOD1_ORYSJ DNA polymerase delta catalytic subunit OS=Oryza sativa subsp. japonica GN=POLD1 PE=2 SV=1 2 252 5.0E-99
sp|Q9LVN7|DPOD1_ARATH DNA polymerase delta catalytic subunit OS=Arabidopsis thaliana GN=POLD1 PE=2 SV=2 2 251 2.0E-96
sp|P28339|DPOD1_BOVIN DNA polymerase delta catalytic subunit OS=Bos taurus GN=POLD1 PE=1 SV=1 2 259 1.0E-95
sp|O54747|DPOD1_RAT DNA polymerase delta catalytic subunit OS=Rattus norvegicus GN=Pold1 PE=2 SV=1 2 259 3.0E-95
sp|P28340|DPOD1_HUMAN DNA polymerase delta catalytic subunit OS=Homo sapiens GN=POLD1 PE=1 SV=2 2 259 6.0E-95
sp|P52431|DPOD1_MOUSE DNA polymerase delta catalytic subunit OS=Mus musculus GN=Pold1 PE=1 SV=2 2 259 1.0E-94
sp|P97283|DPOD1_MESAU DNA polymerase delta catalytic subunit OS=Mesocricetus auratus GN=POLD1 PE=2 SV=1 2 259 3.0E-94
sp|P54358|DPOD1_DROME DNA polymerase delta catalytic subunit OS=Drosophila melanogaster GN=DNApol-delta PE=2 SV=2 2 251 8.0E-90
sp|P90829|DPOD1_CAEEL DNA polymerase delta catalytic subunit OS=Caenorhabditis elegans GN=F10C2.4 PE=3 SV=1 2 251 6.0E-85
sp|Q54N97|DPOD1_DICDI DNA polymerase delta catalytic subunit OS=Dictyostelium discoideum GN=pold1 PE=3 SV=1 2 254 7.0E-77
sp|P15436|DPOD_YEAST DNA polymerase delta catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL3 PE=1 SV=4 2 251 2.0E-70
sp|P30315|DPOD1_PLAFK DNA polymerase delta catalytic subunit OS=Plasmodium falciparum (isolate K1 / Thailand) GN=POLD1 PE=3 SV=1 2 254 1.0E-63
sp|O48901|DPOD1_SOYBN DNA polymerase delta catalytic subunit OS=Glycine max GN=POLD1 PE=2 SV=1 2 156 6.0E-60
sp|A7U6F1|DPOL_CEV01 DNA polymerase OS=Chrysochromulina ericina virus GN=dpo PE=3 SV=1 1 123 9.0E-16
sp|A7U6F2|DPOL_POV01 DNA polymerase OS=Pyramimonas orientalis virus GN=dpo PE=3 SV=1 1 115 1.0E-14
sp|Q9QJ32|DPOL_HHV6Z DNA polymerase catalytic subunit OS=Human herpesvirus 6B (strain Z29) GN=U38 PE=3 SV=1 21 123 2.0E-12
sp|P14284|DPOZ_YEAST DNA polymerase zeta catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REV3 PE=1 SV=1 1 243 4.0E-12
sp|P28857|DPOL_HHV6U DNA polymerase catalytic subunit OS=Human herpesvirus 6A (strain Uganda-1102) GN=U38 PE=3 SV=1 21 123 5.0E-12
sp|Q5UQR0|DPOL_MIMIV DNA polymerase OS=Acanthamoeba polyphaga mimivirus GN=POLB PE=3 SV=1 2 123 8.0E-12
sp|Q58295|DPOL_METJA DNA polymerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pol PE=3 SV=2 2 127 1.0E-11
sp|P52025|DPOL_METVO DNA polymerase OS=Methanococcus voltae GN=pol PE=3 SV=1 2 122 2.0E-11
sp|Q69025|DPOL_GPCMV DNA polymerase OS=Guinea pig cytomegalovirus (strain 22122) GN=UL54 PE=3 SV=3 21 130 3.0E-11
sp|O60673|DPOLZ_HUMAN DNA polymerase zeta catalytic subunit OS=Homo sapiens GN=REV3L PE=1 SV=2 6 244 4.0E-11
sp|P52342|DPOL_HHV7J DNA polymerase catalytic subunit OS=Human herpesvirus 7 (strain JI) GN=U38 PE=3 SV=1 10 133 9.0E-11
sp|Q85428|DPOL_RCMVM DNA polymerase catalytic subunit OS=Rat cytomegalovirus (strain Maastricht) GN=UL54 PE=3 SV=2 17 187 1.0E-10
sp|Q766Z3|REV3_ARATH DNA polymerase zeta catalytic subunit OS=Arabidopsis thaliana GN=REV3 PE=2 SV=1 5 241 5.0E-10
sp|P30320|DPOL_PBCVN DNA polymerase OS=Paramecium bursaria Chlorella virus NY2A GN=DPO PE=3 SV=1 2 128 6.0E-10
sp|O71121|DPOL_RHCM6 DNA polymerase catalytic subunit OS=Rhesus cytomegalovirus (strain 68-1) GN=UL54 PE=3 SV=1 21 130 8.0E-10
sp|P30321|DPOL_PBCV1 DNA polymerase OS=Paramecium bursaria Chlorella virus 1 GN=DPO PE=3 SV=2 2 125 1.0E-09
sp|Q9YUS2|DPOL_TUHV2 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus (strain 2) GN=DPOL PE=3 SV=1 21 130 9.0E-09
sp|Q9YUS3|DPOL_TUHV1 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus 1 (strain 1) GN=DPOL PE=3 SV=1 21 130 9.0E-09
sp|O29753|DPOL_ARCFU DNA polymerase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pol PE=3 SV=1 1 120 1.0E-08
sp|Q9P6L6|DPOZ_SCHPO DNA polymerase zeta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rev3 PE=3 SV=1 52 238 2.0E-08
sp|P30317|DPOL_THELI DNA polymerase OS=Thermococcus litoralis GN=pol PE=1 SV=1 2 120 2.0E-07
sp|O93746|DPOL2_AERPE DNA polymerase 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=polB PE=3 SV=3 1 120 2.0E-07
sp|O33845|DPOL_THEAG DNA polymerase OS=Thermococcus aggregans GN=pol PE=3 SV=1 2 120 5.0E-07
sp|O89042|DPOLA_RAT DNA polymerase alpha catalytic subunit (Fragment) OS=Rattus norvegicus GN=Pola1 PE=2 SV=1 8 124 3.0E-06
sp|P09884|DPOLA_HUMAN DNA polymerase alpha catalytic subunit OS=Homo sapiens GN=POLA1 PE=1 SV=2 8 124 3.0E-06
sp|P28040|DPOA_SCHPO DNA polymerase alpha catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol1 PE=1 SV=1 3 129 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000166 nucleotide binding Yes
GO:0003677 DNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7703
MILIERDVQGAQAYVKDTIADLLQNKVDMSKLVITKALTKDDYTAKQAHVELAQRMKKRDAGSAPGLGDRVAYVM
VKGAAGAKNFEKSEDPIYVLENNVPIDTKYYLDNQLAKPLGRIFEPILGESKARQLLTGDHTRTISVAAPAVGGL
MRFAKKTQTCMGCKKPLTGKEERAGAVCADCGPRVGELYKRTLDRVSELEVRFGRLWTQCQRCQGSMHCEVICSS
KDCPIFYMRMKAKKDLEDAGRELKRFDADQAALW*
Coding >Hirsu2|7703
ATGATTCTGATTGAGCGGGACGTGCAAGGGGCACAGGCCTACGTCAAGGACACGATCGCGGACCTGCTGCAGAAC
AAGGTCGACATGTCGAAGCTGGTGATCACCAAGGCGCTGACCAAGGACGACTACACGGCCAAGCAGGCGCACGTG
GAGCTGGCGCAGCGGATGAAGAAGCGCGACGCCGGGTCGGCGCCCGGGCTGGGGGACCGGGTGGCGTACGTCATG
GTCAAGGGGGCGGCGGGGGCCAAGAACTTTGAGAAGTCGGAGGACCCGATCTACGTGCTGGAGAACAACGTGCCG
ATCGACACCAAGTACTACCTGGACAACCAGCTGGCCAAGCCGCTGGGGCGCATCTTCGAGCCGATCCTGGGGGAG
AGCAAGGCGCGGCAGCTGCTGACGGGGGACCACACGCGGACCATCTCGGTGGCGGCGCCGGCGGTCGGGGGCCTG
ATGCGGTTCGCCAAGAAGACGCAGACGTGCATGGGGTGCAAGAAGCCGCTGACGGGCAAGGAGGAGAGGGCCGGG
GCCGTGTGCGCCGACTGCGGGCCGCGGGTGGGCGAGCTGTACAAGCGGACGCTGGACCGGGTGTCGGAGCTCGAG
GTGCGGTTCGGGCGGCTGTGGACGCAGTGCCAGCGGTGCCAGGGCAGCATGCACTGCGAGGTCATCTGCAGCAGC
AAGGACTGCCCCATCTTCTACATGCGGATGAAGGCCAAGAAGGACCTGGAGGACGCGGGCCGGGAGCTGAAGCGG
TTCGACGCCGACCAGGCGGCCCTGTGGTGA
Transcript >Hirsu2|7703
ATGATTCTGATTGAGCGGGACGTGCAAGGGGCACAGGCCTACGTCAAGGACACGATCGCGGACCTGCTGCAGAAC
AAGGTCGACATGTCGAAGCTGGTGATCACCAAGGCGCTGACCAAGGACGACTACACGGCCAAGCAGGCGCACGTG
GAGCTGGCGCAGCGGATGAAGAAGCGCGACGCCGGGTCGGCGCCCGGGCTGGGGGACCGGGTGGCGTACGTCATG
GTCAAGGGGGCGGCGGGGGCCAAGAACTTTGAGAAGTCGGAGGACCCGATCTACGTGCTGGAGAACAACGTGCCG
ATCGACACCAAGTACTACCTGGACAACCAGCTGGCCAAGCCGCTGGGGCGCATCTTCGAGCCGATCCTGGGGGAG
AGCAAGGCGCGGCAGCTGCTGACGGGGGACCACACGCGGACCATCTCGGTGGCGGCGCCGGCGGTCGGGGGCCTG
ATGCGGTTCGCCAAGAAGACGCAGACGTGCATGGGGTGCAAGAAGCCGCTGACGGGCAAGGAGGAGAGGGCCGGG
GCCGTGTGCGCCGACTGCGGGCCGCGGGTGGGCGAGCTGTACAAGCGGACGCTGGACCGGGTGTCGGAGCTCGAG
GTGCGGTTCGGGCGGCTGTGGACGCAGTGCCAGCGGTGCCAGGGCAGCATGCACTGCGAGGTCATCTGCAGCAGC
AAGGACTGCCCCATCTTCTACATGCGGATGAAGGCCAAGAAGGACCTGGAGGACGCGGGCCGGGAGCTGAAGCGG
TTCGACGCCGACCAGGCGGCCCTGTGGTGA
Gene >Hirsu2|7703
ATGATTCTGATTGAGCGGGACGTGCAAGGGGCACAGGCGTAAGTCGGCTGCCCCGAGAGTATGGAGAGAGAGGAG
CTGACGGGATGGATGACAGCTACGTCAAGGACACGATCGCGGACCTGCTGCAGAACAAGGTCGACATGTCGAAGC
TGGTGATCACCAAGGCGCTGACCAAGGACGACTACACGGCCAAGCAGGCGCACGTGGAGCTGGCGCAGCGGATGA
AGAAGCGCGACGCCGGGTCGGCGCCCGGGCTGGGGGACCGGGTGGCGTACGTCATGGTCAAGGGGGCGGCGGGGG
CCAAGAACTTTGAGAAGTCGGAGGACCCGATCTACGTGCTGGAGAACAACGTGCCGATCGACACCAAGTACTACC
TGGACAACCAGCTGGCCAAGCCGCTGGGGCGCATCTTCGAGCCGATCCTGGGGGAGAGCAAGGCGCGGCAGCTGC
TGACGGGGGACCACACGCGGACCATCTCGGTGGCGGCGCCGGCGGTCGGGGGCCTGATGCGGTTCGCCAAGAAGA
CGCAGACGTGCATGGGGTGCAAGAAGCCGCTGACGGGCAAGGAGGAGAGGGCCGGGGCCGTGTGCGCCGACTGCG
GGCCGCGGGTGGGCGAGCTGTACAAGCGGACGCTGGACCGGGTGTCGGAGCTCGAGGTGCGGTTCGGGCGGCTGT
GGACGCAGTGCCAGCGGTGCCAGGGCAGCATGCACTGCGAGGTCATCTGCAGCAGCAAGGACTGCCCCATCTTCT
ACATGCGGATGAAGGCCAAGAAGGACCTGGAGGACGCGGGCCGGGAGCTGAAGCGGTTCGACGCCGACCAGGCGG
CCCTGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail