Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7696
Gene name
LocationContig_462:52..265
Strand+
Gene length (bp)213
Transcript length (bp)213
Coding sequence length (bp)213
Protein length (aa) 71

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12678 zf-rbx1 RING-H2 zinc finger domain 2.1E-12 5 64
PF13639 zf-RING_2 Ring finger domain 1.3E-09 37 64
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.8E-08 6 63
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 7.9E-07 37 63
PF14634 zf-RING_5 zinc-RING finger domain 1.1E-07 6 64
PF13445 zf-RING_UBOX RING-type zinc-finger 3.1E-05 6 54

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36096|TUL1_YEAST Transmembrane E3 ubiquitin-protein ligase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUL1 PE=1 SV=1 4 70 2.0E-16
sp|O43085|DSC1_SCHPO DSC E3 ubiquitin ligase complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dsc1 PE=1 SV=2 6 70 2.0E-10
sp|Q9SK92|ATL15_ARATH E3 ubiquitin-protein ligase ATL15 OS=Arabidopsis thaliana GN=ATL15 PE=1 SV=1 8 70 6.0E-08
sp|Q9C7I1|ATL34_ARATH RING-H2 finger protein ATL34 OS=Arabidopsis thaliana GN=ATL34 PE=2 SV=1 3 69 9.0E-08
sp|Q84W40|ATL11_ARATH RING-H2 finger protein ATL11 OS=Arabidopsis thaliana GN=ATL11 PE=2 SV=2 8 70 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36096|TUL1_YEAST Transmembrane E3 ubiquitin-protein ligase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUL1 PE=1 SV=1 4 70 2.0E-16
sp|O43085|DSC1_SCHPO DSC E3 ubiquitin ligase complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dsc1 PE=1 SV=2 6 70 2.0E-10
sp|Q9SK92|ATL15_ARATH E3 ubiquitin-protein ligase ATL15 OS=Arabidopsis thaliana GN=ATL15 PE=1 SV=1 8 70 6.0E-08
sp|Q9C7I1|ATL34_ARATH RING-H2 finger protein ATL34 OS=Arabidopsis thaliana GN=ATL34 PE=2 SV=1 3 69 9.0E-08
sp|Q84W40|ATL11_ARATH RING-H2 finger protein ATL11 OS=Arabidopsis thaliana GN=ATL11 PE=2 SV=2 8 70 2.0E-07
sp|Q5XHH7|SYVNB_XENLA E3 ubiquitin-protein ligase synoviolin B OS=Xenopus laevis GN=syvn1-b PE=2 SV=1 1 67 5.0E-07
sp|Q6NRL6|SYVNA_XENLA E3 ubiquitin-protein ligase synoviolin A OS=Xenopus laevis GN=syvn1-a PE=2 SV=1 1 67 7.0E-07
sp|Q9C919|ATL19_ARATH Putative RING-H2 finger protein ATL19 OS=Arabidopsis thaliana GN=ATL19 PE=3 SV=1 41 68 3.0E-06
sp|Q9ZU51|RHA2B_ARATH Probable E3 ubiquitin-protein ligase RHA2B OS=Arabidopsis thaliana GN=RHA2B PE=1 SV=2 3 69 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7696
LRAIDCAICREALEVPVLRAGDEDGSVAGVFARRLYMVTPCRHIFHTACLEGWMRFRLQCPICREDLPPV*
Coding >Hirsu2|7696
CTGCGCGCCATCGACTGCGCCATCTGCCGCGAGGCCCTCGAGGTGCCCGTCCTGCGCGCCGGCGACGAGGACGGC
TCCGTCGCCGGCGTCTTCGCCCGCCGCCTCTACATGGTCACGCCCTGCCGCCACATCTTCCACACCGCCTGCCTC
GAGGGCTGGATGCGCTTCCGCCTGCAGTGCCCCATCTGCAGGGAGGACCTGCCGCCCGTCTGA
Transcript >Hirsu2|7696
CTGCGCGCCATCGACTGCGCCATCTGCCGCGAGGCCCTCGAGGTGCCCGTCCTGCGCGCCGGCGACGAGGACGGC
TCCGTCGCCGGCGTCTTCGCCCGCCGCCTCTACATGGTCACGCCCTGCCGCCACATCTTCCACACCGCCTGCCTC
GAGGGCTGGATGCGCTTCCGCCTGCAGTGCCCCATCTGCAGGGAGGACCTGCCGCCCGTCTGA
Gene >Hirsu2|7696
CTGCGCGCCATCGACTGCGCCATCTGCCGCGAGGCCCTCGAGGTGCCCGTCCTGCGCGCCGGCGACGAGGACGGC
TCCGTCGCCGGCGTCTTCGCCCGCCGCCTCTACATGGTCACGCCCTGCCGCCACATCTTCCACACCGCCTGCCTC
GAGGGCTGGATGCGCTTCCGCCTGCAGTGCCCCATCTGCAGGGAGGACCTGCCGCCCGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail