Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7680
Gene name
LocationContig_46:43894..44505
Strand+
Gene length (bp)611
Transcript length (bp)543
Coding sequence length (bp)543
Protein length (aa) 181

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01554 MatE MatE 2.3E-16 5 155

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q05497|YD338_YEAST Uncharacterized transporter YDR338C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR338C PE=1 SV=1 1 174 4.0E-30
sp|P38767|ERC1_YEAST Ethionine resistance-conferring protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERC1 PE=1 SV=1 1 138 9.0E-29
sp|Q9USK3|YJ2D_SCHPO Uncharacterized transporter C4B3.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4B3.13 PE=3 SV=1 1 170 8.0E-26
sp|Q10085|YAO6_SCHPO Uncharacterized transporter C11D3.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.06 PE=3 SV=1 1 177 4.0E-22
sp|Q9UT92|YL47_SCHPO Uncharacterized transporter C323.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC323.07c PE=1 SV=1 1 174 5.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q05497|YD338_YEAST Uncharacterized transporter YDR338C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR338C PE=1 SV=1 1 174 4.0E-30
sp|P38767|ERC1_YEAST Ethionine resistance-conferring protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERC1 PE=1 SV=1 1 138 9.0E-29
sp|Q9USK3|YJ2D_SCHPO Uncharacterized transporter C4B3.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4B3.13 PE=3 SV=1 1 170 8.0E-26
sp|Q10085|YAO6_SCHPO Uncharacterized transporter C11D3.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.06 PE=3 SV=1 1 177 4.0E-22
sp|Q9UT92|YL47_SCHPO Uncharacterized transporter C323.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC323.07c PE=1 SV=1 1 174 5.0E-22
sp|Q8K0H1|S47A1_MOUSE Multidrug and toxin extrusion protein 1 OS=Mus musculus GN=Slc47a1 PE=1 SV=2 1 176 2.0E-19
sp|Q5RFD2|S47A1_PONAB Multidrug and toxin extrusion protein 1 OS=Pongo abelii GN=SLC47A1 PE=2 SV=1 1 176 5.0E-18
sp|A7KAU2|S47A1_RABIT Multidrug and toxin extrusion protein 1 OS=Oryctolagus cuniculus GN=SLC47A1 PE=2 SV=1 1 159 6.0E-18
sp|Q96FL8|S47A1_HUMAN Multidrug and toxin extrusion protein 1 OS=Homo sapiens GN=SLC47A1 PE=1 SV=1 1 176 7.0E-18
sp|Q5I0E9|S47A1_RAT Multidrug and toxin extrusion protein 1 OS=Rattus norvegicus GN=Slc47a1 PE=1 SV=1 1 176 2.0E-17
sp|Q9C994|DTX14_ARATH Protein DETOXIFICATION 14 OS=Arabidopsis thaliana GN=DTX14 PE=3 SV=1 1 180 2.0E-16
sp|Q3V050|S47A2_MOUSE Multidrug and toxin extrusion protein 2 OS=Mus musculus GN=Slc47a2 PE=1 SV=1 1 176 3.0E-16
sp|A4IIS8|S47A1_XENTR Multidrug and toxin extrusion protein 1 OS=Xenopus tropicalis GN=slc47a1 PE=2 SV=1 1 159 7.0E-16
sp|A1L1P9|S47A1_DANRE Multidrug and toxin extrusion protein 1 OS=Danio rerio GN=slc47a1 PE=2 SV=1 1 174 5.0E-15
sp|Q86VL8|S47A2_HUMAN Multidrug and toxin extrusion protein 2 OS=Homo sapiens GN=SLC47A2 PE=1 SV=1 1 174 3.0E-14
sp|Q8GXM8|DTX2_ARATH Protein DETOXIFICATION 2 OS=Arabidopsis thaliana GN=DTX2 PE=2 SV=1 5 180 7.0E-14
sp|A7KAU3|S47A2_RABIT Multidrug and toxin extrusion protein 2 OS=Oryctolagus cuniculus GN=SLC47A2 PE=1 SV=1 1 174 8.0E-14
sp|Q9SIA3|DTX4_ARATH Protein DETOXIFICATION 4 OS=Arabidopsis thaliana GN=DTX4 PE=3 SV=2 1 180 4.0E-12
sp|Q9SIA4|DTX3_ARATH Protein DETOXIFICATION 3 OS=Arabidopsis thaliana GN=DTX3 PE=3 SV=1 1 180 6.0E-12
sp|Q1PFG9|DTX7_ARATH Protein DETOXIFICATION 7 OS=Arabidopsis thaliana GN=DTX7 PE=2 SV=1 1 180 7.0E-12
sp|Q9LE20|DTX54_ARATH Protein DETOXIFICATION 54 OS=Arabidopsis thaliana GN=DTX54 PE=2 SV=1 5 178 1.0E-11
sp|O82752|DTX49_ARATH Protein DETOXIFICATION 49 OS=Arabidopsis thaliana GN=DTX49 PE=2 SV=1 5 174 1.0E-11
sp|Q5R7E4|S47A2_PONAB Multidrug and toxin extrusion protein 2 OS=Pongo abelii GN=SLC47A2 PE=2 SV=1 1 174 1.0E-11
sp|F4HQ05|DTX8_ARATH Protein DETOXIFICATION 8 OS=Arabidopsis thaliana GN=DTX8 PE=3 SV=1 1 177 2.0E-11
sp|F4IHU9|DTX15_ARATH Protein DETOXIFICATION 15 OS=Arabidopsis thaliana GN=DTX15 PE=3 SV=1 5 160 1.0E-10
sp|Q8RWF5|DTX6_ARATH Protein DETOXIFICATION 6 OS=Arabidopsis thaliana GN=DTX6 PE=2 SV=1 1 177 1.0E-10
sp|Q9SZE2|DTX51_ARATH Protein DETOXIFICATION 51 OS=Arabidopsis thaliana GN=DTX51 PE=2 SV=1 5 174 1.0E-10
sp|Q9I3Y3|PMPM_PSEAE Multidrug resistance protein PmpM OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pmpM PE=3 SV=1 2 178 2.0E-10
sp|Q8L731|DTX12_ARATH Protein DETOXIFICATION 12 OS=Arabidopsis thaliana GN=DTX12 PE=2 SV=1 1 177 3.0E-10
sp|Q9SIA1|DTX5_ARATH Protein DETOXIFICATION 5 OS=Arabidopsis thaliana GN=DTX5 PE=3 SV=2 1 177 4.0E-10
sp|Q8D9N8|NORM_VIBVU Multidrug resistance protein NorM OS=Vibrio vulnificus (strain CMCP6) GN=norM PE=3 SV=2 5 161 6.0E-10
sp|Q7MKP8|NORM_VIBVY Multidrug resistance protein NorM OS=Vibrio vulnificus (strain YJ016) GN=norM PE=3 SV=2 5 161 7.0E-10
sp|Q5E4Y6|NORM_VIBF1 Multidrug resistance protein NorM OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=norM PE=3 SV=1 9 161 1.0E-09
sp|F4JKB9|DTX38_ARATH Protein DETOXIFICATION 38 OS=Arabidopsis thaliana GN=DTX38 PE=2 SV=1 24 174 4.0E-09
sp|Q9FHB6|DTX16_ARATH Protein DETOXIFICATION 16 OS=Arabidopsis thaliana GN=DTX16 PE=2 SV=1 38 180 5.0E-09
sp|Q9KRU4|NORM_VIBCH Multidrug resistance protein NorM OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=norM PE=3 SV=2 5 161 5.0E-09
sp|Q9SIA5|DTX1_ARATH Protein DETOXIFICATION 1 OS=Arabidopsis thaliana GN=DTX1 PE=2 SV=1 1 177 5.0E-09
sp|Q9C9M8|DTX9_ARATH Protein DETOXIFICATION 9 OS=Arabidopsis thaliana GN=DTX9 PE=2 SV=1 1 177 7.0E-09
sp|Q6D5W6|MDTK_PECAS Multidrug resistance protein MdtK OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mdtK PE=3 SV=1 20 155 7.0E-09
sp|O80695|DTX37_ARATH Protein DETOXIFICATION 37 OS=Arabidopsis thaliana GN=DTX37 PE=2 SV=1 24 174 2.0E-08
sp|Q9SAB0|DTX36_ARATH Protein DETOXIFICATION 36 OS=Arabidopsis thaliana GN=DTX36 PE=2 SV=1 24 174 2.0E-08
sp|Q8RXK1|DTX23_ARATH Protein DETOXIFICATION 23 OS=Arabidopsis thaliana GN=DTX23 PE=2 SV=1 24 180 2.0E-08
sp|Q38956|DTX29_ARATH Protein DETOXIFICATION 29 OS=Arabidopsis thaliana GN=DTX29 PE=1 SV=1 24 180 2.0E-08
sp|Q9ZVH5|DTX53_ARATH Protein DETOXIFICATION 53 OS=Arabidopsis thaliana GN=DTX53 PE=2 SV=1 5 174 2.0E-08
sp|Q9PA34|NORM_XYLFA Probable multidrug resistance protein NorM OS=Xylella fastidiosa (strain 9a5c) GN=norM PE=3 SV=1 18 178 2.0E-08
sp|Q940N9|DTX39_ARATH Protein DETOXIFICATION 39 OS=Arabidopsis thaliana GN=DTX39 PE=2 SV=1 24 174 3.0E-08
sp|Q6NB79|NORM_RHOPA Probable multidrug resistance protein NorM OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=norM PE=3 SV=1 5 180 3.0E-08
sp|Q879Z5|NORM_XYLFT Probable multidrug resistance protein NorM OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=norM PE=3 SV=1 18 178 3.0E-08
sp|F4HPH2|DTX20_ARATH Protein DETOXIFICATION 20 OS=Arabidopsis thaliana GN=DTX20 PE=3 SV=1 24 180 3.0E-08
sp|Q9SLV0|DTX48_ARATH Protein DETOXIFICATION 48 OS=Arabidopsis thaliana GN=DTX48 PE=2 SV=1 5 174 3.0E-08
sp|A1JPA1|MDTK_YERE8 Multidrug resistance protein MdtK OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdtK PE=3 SV=1 5 161 3.0E-08
sp|Q9C9U1|DTX17_ARATH Protein DETOXIFICATION 17 OS=Arabidopsis thaliana GN=DTX17 PE=2 SV=1 1 152 4.0E-08
sp|Q9FJ87|DTX50_ARATH Protein DETOXIFICATION 50 OS=Arabidopsis thaliana GN=DTX50 PE=2 SV=1 5 174 4.0E-08
sp|F4I4Q3|DTX32_ARATH Protein DETOXIFICATION 32 OS=Arabidopsis thaliana GN=DTX32 PE=3 SV=1 24 180 4.0E-08
sp|Q9SX83|DTX33_ARATH Protein DETOXIFICATION 33 OS=Arabidopsis thaliana GN=DTX33 PE=2 SV=1 47 180 5.0E-08
sp|Q94AL1|DTX13_ARATH Protein DETOXIFICATION 13 OS=Arabidopsis thaliana GN=DTX13 PE=2 SV=1 1 177 7.0E-08
sp|Q7WTR3|MDTK_ERWAM Multidrug resistance protein MdtK OS=Erwinia amylovora GN=mdtK PE=3 SV=1 5 161 1.0E-07
sp|O82855|NORM_VIBPA Multidrug resistance protein NorM OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=norM PE=1 SV=2 5 160 1.0E-07
sp|Q9FKQ1|DTX27_ARATH Protein DETOXIFICATION 27 OS=Arabidopsis thaliana GN=DTX27 PE=2 SV=1 1 177 2.0E-07
sp|Q5MZD9|NORM_SYNP6 Probable multidrug resistance protein NorM OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=norM PE=3 SV=1 2 180 2.0E-07
sp|Q8W488|DTX21_ARATH Protein DETOXIFICATION 21 OS=Arabidopsis thaliana GN=DTX21 PE=1 SV=1 47 180 2.0E-07
sp|Q8VYL8|DTX10_ARATH Protein DETOXIFICATION 10 OS=Arabidopsis thaliana GN=DTX10 PE=2 SV=1 1 177 3.0E-07
sp|Q9LUH3|DTX18_ARATH Protein DETOXIFICATION 18 OS=Arabidopsis thaliana GN=DTX18 PE=2 SV=1 1 178 3.0E-07
sp|F4HZH9|DTX11_ARATH Protein DETOXIFICATION 11 OS=Arabidopsis thaliana GN=DTX11 PE=3 SV=1 1 177 7.0E-07
sp|Q9RY44|NORM_DEIRA Probable multidrug resistance protein NorM OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=norM PE=3 SV=1 4 178 9.0E-07
sp|Q9FH21|DTX55_ARATH Protein DETOXIFICATION 55 OS=Arabidopsis thaliana GN=DTX55 PE=2 SV=1 35 174 1.0E-06
sp|Q9LUH2|DTX19_ARATH Protein DETOXIFICATION 19 OS=Arabidopsis thaliana GN=DTX19 PE=2 SV=1 1 178 2.0E-06
sp|Q9LPV4|DTX31_ARATH Protein DETOXIFICATION 31 OS=Arabidopsis thaliana GN=DTX31 PE=2 SV=1 24 177 2.0E-06
sp|Q4PSF4|DTX52_ARATH Protein DETOXIFICATION 52 OS=Arabidopsis thaliana GN=DTX52 PE=2 SV=1 5 178 2.0E-06
sp|Q88CB9|NORM_PSEPK Probable multidrug resistance protein NorM OS=Pseudomonas putida (strain KT2440) GN=norM PE=3 SV=1 1 179 3.0E-06
sp|Q6LQ49|NORM_PHOPR Multidrug resistance protein NorM OS=Photobacterium profundum GN=norM PE=3 SV=1 9 179 3.0E-06
sp|Q8EES3|NORM_SHEON Probable multidrug resistance protein NorM OS=Shewanella oneidensis (strain MR-1) GN=norM PE=3 SV=1 9 178 4.0E-06
sp|Q7VMB5|NORM_HAEDU Probable multidrug resistance protein NorM OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=norM PE=3 SV=1 10 154 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006855 drug transmembrane transport Yes
GO:0015238 drug transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0015297 antiporter activity Yes
GO:0016020 membrane Yes
GO:0022804 active transmembrane transporter activity No
GO:0008150 biological_process No
GO:0015893 drug transport No
GO:0006810 transport No
GO:0015291 secondary active transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0022857 transmembrane transporter activity No
GO:0051179 localization No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 24 46 22
2 67 89 22
3 109 131 22
4 143 165 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7680
MVEAEYLAFEVMIIASSRFGTDYLAAQSILSALATISFQVPFSISIATSTRIAGLIGAGLVDAGKVAAKVAVTAT
WITGCINLFIYTLLQYQLPFIFTDDPVVALLTTQVLPLLSVTTFLEGLAATAHGLLRGIGRQSIGGPATISAYYL
VALPTSLALGVGLGWKLHGLLSGLTIGLAV*
Coding >Hirsu2|7680
ATGGTGGAAGCTGAATATCTTGCCTTCGAGGTCATGATCATCGCTTCCAGCCGGTTCGGCACGGACTACCTCGCG
GCCCAAAGCATCTTGTCGGCCCTCGCAACGATATCCTTCCAGGTTCCGTTTTCGATATCGATCGCCACCTCGACG
AGAATCGCCGGTCTCATTGGCGCTGGACTTGTCGACGCCGGCAAGGTCGCAGCCAAAGTCGCTGTTACCGCGACT
TGGATCACCGGCTGCATCAACTTGTTCATCTACACCTTGCTCCAATACCAGCTGCCCTTCATCTTCACCGATGAC
CCGGTCGTGGCATTGCTGACCACCCAAGTCCTGCCACTCCTCAGTGTCACGACGTTTCTCGAGGGACTTGCCGCG
ACGGCTCATGGCTTGTTACGCGGCATTGGCAGGCAGTCGATTGGCGGACCAGCTACCATCTCCGCGTACTACCTT
GTTGCCCTGCCCACCTCGCTGGCGTTGGGGGTTGGACTTGGCTGGAAACTACACGGTCTACTTTCGGGCCTTACC
ATCGGGCTCGCCGTGTAA
Transcript >Hirsu2|7680
ATGGTGGAAGCTGAATATCTTGCCTTCGAGGTCATGATCATCGCTTCCAGCCGGTTCGGCACGGACTACCTCGCG
GCCCAAAGCATCTTGTCGGCCCTCGCAACGATATCCTTCCAGGTTCCGTTTTCGATATCGATCGCCACCTCGACG
AGAATCGCCGGTCTCATTGGCGCTGGACTTGTCGACGCCGGCAAGGTCGCAGCCAAAGTCGCTGTTACCGCGACT
TGGATCACCGGCTGCATCAACTTGTTCATCTACACCTTGCTCCAATACCAGCTGCCCTTCATCTTCACCGATGAC
CCGGTCGTGGCATTGCTGACCACCCAAGTCCTGCCACTCCTCAGTGTCACGACGTTTCTCGAGGGACTTGCCGCG
ACGGCTCATGGCTTGTTACGCGGCATTGGCAGGCAGTCGATTGGCGGACCAGCTACCATCTCCGCGTACTACCTT
GTTGCCCTGCCCACCTCGCTGGCGTTGGGGGTTGGACTTGGCTGGAAACTACACGGTCTACTTTCGGGCCTTACC
ATCGGGCTCGCCGTGTAA
Gene >Hirsu2|7680
ATGGTGGAAGCTGAATATCTTGCCTTCGAGGTCATGATCATCGCTTCCAGCCGGTTCGGCACGGACTACCTCGCG
GCCCAAAGCATCTTGTCGGCCCTCGCAACGATATCCTTCCAGGTTCCGTTTTCGATATCGATCGCCACCTCGACG
AGAATCGCCGGTCTCATTGGCGCTGGACTTGTCGACGCCGGCAAGGTCGCAGCCAAAGTCGTGAGTTGCTGTTCT
ATGTCTTCCTGGCATGCTCCGGTATATGTTTGCTTACCCAACATTGAACTCAGGCTGTTACCGCGACTTGGATCA
CCGGCTGCATCAACTTGTTCATCTACACCTTGCTCCAATACCAGCTGCCCTTCATCTTCACCGATGACCCGGTCG
TGGCATTGCTGACCACCCAAGTCCTGCCACTCCTCAGTGTCACGACGTTTCTCGAGGGACTTGCCGCGACGGCTC
ATGGCTTGTTACGCGGCATTGGCAGGCAGTCGATTGGCGGACCAGCTACCATCTCCGCGTACTACCTTGTTGCCC
TGCCCACCTCGCTGGCGTTGGGGGTTGGACTTGGCTGGAAACTACACGGTCTACTTTCGGGCCTTACCATCGGGC
TCGCCGTGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail