Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7673
Gene name
LocationContig_46:21310..23985
Strand-
Gene length (bp)2675
Transcript length (bp)1545
Coding sequence length (bp)1545
Protein length (aa) 515

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04116 FA_hydroxylase Fatty acid hydroxylase superfamily 4.6E-23 74 209

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94298|SUR2_SCHPO Sphingolipid C4-hydroxylase sur2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sur2 PE=3 SV=1 38 214 2.0E-39
sp|Q9AST3|SBH2_ARATH Sphinganine C4-monooxygenase 2 OS=Arabidopsis thaliana GN=SBH2 PE=1 SV=1 41 210 2.0E-37
sp|Q8VYI1|SBH1_ARATH Sphinganine C4-monooxygenase 1 OS=Arabidopsis thaliana GN=SBH1 PE=1 SV=1 67 210 2.0E-36
sp|P38992|SUR2_YEAST Sphingolipid C4-hydroxylase SUR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUR2 PE=1 SV=1 65 241 1.0E-29
sp|Q9ZW22|SMO21_ARATH Methylsterol monooxygenase 2-1 OS=Arabidopsis thaliana GN=SMO2-1 PE=2 SV=2 66 188 3.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94298|SUR2_SCHPO Sphingolipid C4-hydroxylase sur2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sur2 PE=3 SV=1 38 214 2.0E-39
sp|Q9AST3|SBH2_ARATH Sphinganine C4-monooxygenase 2 OS=Arabidopsis thaliana GN=SBH2 PE=1 SV=1 41 210 2.0E-37
sp|Q8VYI1|SBH1_ARATH Sphinganine C4-monooxygenase 1 OS=Arabidopsis thaliana GN=SBH1 PE=1 SV=1 67 210 2.0E-36
sp|P38992|SUR2_YEAST Sphingolipid C4-hydroxylase SUR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUR2 PE=1 SV=1 65 241 1.0E-29
sp|Q9ZW22|SMO21_ARATH Methylsterol monooxygenase 2-1 OS=Arabidopsis thaliana GN=SMO2-1 PE=2 SV=2 66 188 3.0E-12
sp|Q8VWZ8|SMO22_ARATH Methylsterol monooxygenase 2-2 OS=Arabidopsis thaliana GN=SMO2-2 PE=2 SV=1 73 188 2.0E-11
sp|Q5ZLL6|MSMO1_CHICK Methylsterol monooxygenase 1 OS=Gallus gallus GN=MSMO1 PE=2 SV=1 66 223 6.0E-11
sp|Q8L7W5|SMO11_ARATH Methylsterol monooxygenase 1-1 OS=Arabidopsis thaliana GN=SMO1-1 PE=1 SV=1 73 242 1.0E-09
sp|Q55D54|MSMOB_DICDI Putative methylsterol monooxygenase DDB_G0269788 OS=Dictyostelium discoideum GN=DDB_G0269788 PE=3 SV=1 69 228 2.0E-09
sp|O35532|MSMO1_RAT Methylsterol monooxygenase 1 OS=Rattus norvegicus GN=Msmo1 PE=2 SV=1 79 209 4.0E-09
sp|Q9CRA4|MSMO1_MOUSE Methylsterol monooxygenase 1 OS=Mus musculus GN=Msmo1 PE=1 SV=1 79 209 4.0E-09
sp|Q6UGB2|MSMO1_PIG Methylsterol monooxygenase 1 OS=Sus scrofa GN=MSMO1 PE=2 SV=1 66 209 4.0E-09
sp|P52579|IFRH_TOBAC Isoflavone reductase homolog A622 OS=Nicotiana tabacum PE=2 SV=1 234 448 4.0E-09
sp|Q7ZW77|MSMO1_DANRE Methylsterol monooxygenase 1 OS=Danio rerio GN=msmo1 PE=2 SV=1 66 209 6.0E-09
sp|Q7SBB6|ERG3_NEUCR Probable Delta(7)-sterol 5(6)-desaturase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06207 PE=3 SV=1 72 235 6.0E-09
sp|Q5R574|MSMO1_PONAB Methylsterol monooxygenase 1 OS=Pongo abelii GN=MSMO1 PE=2 SV=1 66 209 8.0E-09
sp|Q15800|MSMO1_HUMAN Methylsterol monooxygenase 1 OS=Homo sapiens GN=MSMO1 PE=1 SV=1 66 209 8.0E-09
sp|Q9UUH4|MSMO_SCHPO Methylsterol monooxygenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg25 PE=3 SV=1 72 242 2.0E-08
sp|Q4R4Q4|MSMO1_MACFA Methylsterol monooxygenase 1 OS=Macaca fascicularis GN=MSMO1 PE=2 SV=1 66 209 4.0E-08
sp|Q1LX59|C2512_DANRE Cholesterol 25-hydroxylase-like protein 1, member 2 OS=Danio rerio GN=ch25hl1.2 PE=3 SV=1 78 210 1.0E-07
sp|P53045|MSMO_YEAST Methylsterol monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG25 PE=1 SV=1 78 236 3.0E-07
sp|Q8J207|ERG3_LEPMC Delta(7)-sterol 5(6)-desaturase OS=Leptosphaeria maculans GN=ERG3 PE=3 SV=1 73 223 8.0E-07
sp|P52576|IFR_PEA Isoflavone reductase OS=Pisum sativum GN=IFR PE=2 SV=1 282 507 1.0E-06
sp|Q567X1|C25L1_DANRE Cholesterol 25-hydroxylase-like protein 1, member 1 OS=Danio rerio GN=ch25hl1.1 PE=2 SV=2 77 214 3.0E-06
sp|Q5PRC0|CH25H_DANRE Cholesterol 25-hydroxylase-like protein OS=Danio rerio GN=ch25h PE=2 SV=1 77 211 6.0E-06
sp|P32353|ERG3_YEAST Delta(7)-sterol 5(6)-desaturase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG3 PE=1 SV=1 68 210 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0008610 lipid biosynthetic process Yes
GO:0005506 iron ion binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0046872 metal ion binding No
GO:0008152 metabolic process No
GO:0043169 cation binding No
GO:0008150 biological_process No
GO:0009058 biosynthetic process No
GO:0043167 ion binding No
GO:1901576 organic substance biosynthetic process No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0006629 lipid metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 58 80 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7673
MTGSEDHDLAVWIGRVRSVFAATINLLSLSGIDFKMIATTMSRSRAVRSVVGQTELEVLTGSLIYWYIVPAFQFV
FALVVADASMYCIHRLGHTNKWIYKHIHSHHHRLYVPYSWGGSYNHPVDSLFLDGTSYAIGCWASGISIKLSVFL
FAYATFKNVLDHCGFVFPWNPMRSLTGTDADFHDVHHQSWGLKMNFGAHLSIWDHMMGTHFSDKELISKLRLKNR
IAAEELVSKRSTKSKKGAFFEQRGINVRVSDYSTDSVLQILNETNASALISFNNSDGQTFVDVHSAFLEACRKSK
NCKRFIPSEFAGNIDDFPLHPSYFKTSRVPFRKILEQESDVEWTIFNNGWLMDYFLTEEKSYMPSIPNEFPIDPN
NWRACIRGSGNEVQSFTSGRDVAKALIALLSAAEWERTTYITGQWSTFNEMLRAMEEFYGRPMDKTYKSEEDIHR
DTLLPPTAENLEALYLSSVEEMMITASGACPREKTMNQRDKFFPSIRFLTLEELLLQTGSTRSK*
Coding >Hirsu2|7673
ATGACGGGAAGCGAGGATCATGATCTAGCTGTCTGGATCGGTCGAGTACGCTCCGTCTTTGCAGCAACCATCAAC
TTGCTCTCCCTCAGTGGCATCGACTTCAAGATGATAGCGACCACTATGTCCAGATCCAGAGCTGTCCGCTCTGTA
GTTGGACAAACTGAGCTTGAAGTACTAACAGGTAGTCTGATCTACTGGTACATCGTGCCAGCTTTCCAATTTGTA
TTTGCCCTGGTCGTTGCCGATGCCTCCATGTACTGCATTCATCGCCTAGGACATACCAACAAATGGATCTATAAA
CACATCCACTCGCATCATCATAGGCTGTACGTCCCCTATTCGTGGGGCGGGTCGTACAACCACCCAGTCGATAGC
TTGTTCCTCGACGGCACCAGTTATGCCATCGGCTGCTGGGCATCCGGAATATCAATCAAGCTCTCGGTTTTTCTC
TTTGCATACGCGACATTCAAGAATGTACTTGATCATTGCGGCTTCGTCTTTCCGTGGAATCCGATGCGATCGCTC
ACGGGAACTGATGCCGACTTCCACGACGTCCATCACCAGAGTTGGGGCTTGAAGATGAACTTCGGAGCCCATTTG
AGTATCTGGGATCACATGATGGGAACTCATTTTTCCGATAAAGAACTGATTTCGAAGCTTCGCCTTAAGAATCGC
ATTGCGGCCGAGGAGCTCGTATCCAAAAGATCGACCAAGTCCAAGAAAGGGGCCTTCTTCGAGCAACGTGGTATA
AATGTGCGCGTCAGTGATTACAGCACGGATTCCGTCCTCCAGATCTTGAACGAGACGAATGCCAGTGCTTTGATA
TCATTCAACAATAGCGATGGCCAGACCTTCGTCGATGTGCACAGCGCCTTCCTGGAAGCTTGTCGCAAGTCGAAG
AACTGCAAGCGGTTCATACCCTCAGAATTCGCTGGCAATATTGATGATTTTCCACTGCATCCCAGCTATTTCAAA
ACGTCACGGGTGCCGTTTCGCAAGATTCTTGAACAAGAGTCGGATGTGGAGTGGACGATATTCAACAACGGTTGG
TTGATGGACTACTTCTTGACCGAAGAGAAATCGTACATGCCTTCCATCCCGAATGAATTTCCAATTGATCCAAAC
AACTGGAGGGCGTGTATCCGGGGTTCTGGTAATGAGGTGCAGTCTTTCACAAGTGGTCGAGACGTCGCGAAAGCG
CTCATTGCGCTGCTCAGCGCGGCGGAATGGGAGCGCACGACGTACATCACCGGCCAATGGTCGACCTTTAACGAA
ATGTTGCGAGCCATGGAAGAATTCTACGGCCGACCGATGGACAAGACTTACAAGTCTGAGGAGGATATCCATCGC
GACACTTTGCTGCCTCCTACAGCCGAAAATCTGGAGGCACTCTATCTTTCAAGCGTAGAGGAGATGATGATAACG
GCTTCAGGCGCCTGTCCTCGTGAAAAGACCATGAATCAGCGCGACAAGTTCTTCCCTAGCATTCGTTTTTTAACG
CTTGAGGAGCTCCTGTTGCAGACAGGGTCTACAAGGTCAAAGTAA
Transcript >Hirsu2|7673
ATGACGGGAAGCGAGGATCATGATCTAGCTGTCTGGATCGGTCGAGTACGCTCCGTCTTTGCAGCAACCATCAAC
TTGCTCTCCCTCAGTGGCATCGACTTCAAGATGATAGCGACCACTATGTCCAGATCCAGAGCTGTCCGCTCTGTA
GTTGGACAAACTGAGCTTGAAGTACTAACAGGTAGTCTGATCTACTGGTACATCGTGCCAGCTTTCCAATTTGTA
TTTGCCCTGGTCGTTGCCGATGCCTCCATGTACTGCATTCATCGCCTAGGACATACCAACAAATGGATCTATAAA
CACATCCACTCGCATCATCATAGGCTGTACGTCCCCTATTCGTGGGGCGGGTCGTACAACCACCCAGTCGATAGC
TTGTTCCTCGACGGCACCAGTTATGCCATCGGCTGCTGGGCATCCGGAATATCAATCAAGCTCTCGGTTTTTCTC
TTTGCATACGCGACATTCAAGAATGTACTTGATCATTGCGGCTTCGTCTTTCCGTGGAATCCGATGCGATCGCTC
ACGGGAACTGATGCCGACTTCCACGACGTCCATCACCAGAGTTGGGGCTTGAAGATGAACTTCGGAGCCCATTTG
AGTATCTGGGATCACATGATGGGAACTCATTTTTCCGATAAAGAACTGATTTCGAAGCTTCGCCTTAAGAATCGC
ATTGCGGCCGAGGAGCTCGTATCCAAAAGATCGACCAAGTCCAAGAAAGGGGCCTTCTTCGAGCAACGTGGTATA
AATGTGCGCGTCAGTGATTACAGCACGGATTCCGTCCTCCAGATCTTGAACGAGACGAATGCCAGTGCTTTGATA
TCATTCAACAATAGCGATGGCCAGACCTTCGTCGATGTGCACAGCGCCTTCCTGGAAGCTTGTCGCAAGTCGAAG
AACTGCAAGCGGTTCATACCCTCAGAATTCGCTGGCAATATTGATGATTTTCCACTGCATCCCAGCTATTTCAAA
ACGTCACGGGTGCCGTTTCGCAAGATTCTTGAACAAGAGTCGGATGTGGAGTGGACGATATTCAACAACGGTTGG
TTGATGGACTACTTCTTGACCGAAGAGAAATCGTACATGCCTTCCATCCCGAATGAATTTCCAATTGATCCAAAC
AACTGGAGGGCGTGTATCCGGGGTTCTGGTAATGAGGTGCAGTCTTTCACAAGTGGTCGAGACGTCGCGAAAGCG
CTCATTGCGCTGCTCAGCGCGGCGGAATGGGAGCGCACGACGTACATCACCGGCCAATGGTCGACCTTTAACGAA
ATGTTGCGAGCCATGGAAGAATTCTACGGCCGACCGATGGACAAGACTTACAAGTCTGAGGAGGATATCCATCGC
GACACTTTGCTGCCTCCTACAGCCGAAAATCTGGAGGCACTCTATCTTTCAAGCGTAGAGGAGATGATGATAACG
GCTTCAGGCGCCTGTCCTCGTGAAAAGACCATGAATCAGCGCGACAAGTTCTTCCCTAGCATTCGTTTTTTAACG
CTTGAGGAGCTCCTGTTGCAGACAGGGTCTACAAGGTCAAAGTAA
Gene >Hirsu2|7673
ATGACGGGAAGCGAGGATCATGATCTAGCTGTCTGGATCGGTCGAGTACGCTCCGTCTTTGCAGCAACCATCAAC
TTGCTCTCCCTCAGTGGCATCGACTTCAAGATGATAGCGACCACTATGTCCAGATCCAGAGCTGTCCGCTCTGTA
GTTGGACAAACTGAGCTTGAAGTACTAACAGGTAGTCTGATCTACTGGTACATCGTGCCAGCTTTCCAATTTGTA
TTTGCCCTGGTCGTTGCCGATGCCTCCATGTACTGCATTCATCGCCTAGGACATACCAACAAATGGATCTATAGT
AAGCCCCGAGAACTCTGCCCAAAGAATTTCCAGCAACTGAAAAGTTTTAGAACACATCCACTCGCATCATCATAG
GCTGTACGTCCCCTATTCGTGGGGCGGGTCGTACAACCACCCAGTCGATAGCTTGTTCCTCGACGGCACCAGTTA
TGCCATCGGCTGCTGGGCATCCGGAATATCAATCAAGCTCTCGGTTTTTCTCTTTGCATACGCGACATTCAAGAA
TGTACTTGATCATTGCGGCTTCGTCTTTCCGTGGAATCCGATGCGATCGCTCACGGGAACTGATGCCGACTTCCA
CGACGTCCATCACCAGAGTTGGGGCTTGAAGGTAAGTTCTGCACCCGGACCAGTTGCAATAGGCTTCGGCTGATT
TCGACCAAGATGAACTTCGGAGCCCATTTGAGTATCTGGGATCACATGATGGGAACTCATTTTTCCGATAAAGAA
CTGATTTCGAAGCTTCGCCTTAAGAATCGCATTGCGGCCGAGGAGCTCGTATCCAAAAGGTAGCGTCGAGCTTGC
TATTGATATGTGGCTTACCAAAGACGAAAAGGTCTGTAGCTAGGGTGATGTCTCAATGTTTATTGGTGAATAAAA
AGGTCTCATCTTCGTCAAGGAATAAAAGTCGCTGGGGCCATGTGTGGATCGTACTATACCTGCTTCAAGTTTGCT
TAGATCGTTCGAAAATCGTAAACGAATAAACGGTTATTCCTGGGCATATACAATCCCAAAAGAAACGTCGAGGCT
ACAAGAGTTTGAAATATCAGCACGACGTGCAGGATCCCGACTACGTACGGAGCCGTTCCCAGTAAGCCGCATGTG
TATGTAGTGTAGTACGTTGTATGTTGCGTGAATGCTGCGAGTGATATTCATCTTGGCATGAGGCTCTGATCGTTT
CCTGCCGCCAACTCACGTGTATAAGTGATCTGCTACGGGAACAGGTGTCCCAAACCACTTCCCTGGATCATTTAC
AGGCTATCCTGCGCCTTTCTGCCCTCTTCTCTCGCTGATGATAGAACTGATCATGGCTTCTGGTAGCCGTATTTT
GTCCCTGTTCCTGTTCCGTTTTGGACTGTACGCCGGCTATTTGATTCGCCACAGCACGGCTCCGGCATGCACGTG
GAATTAACCGACAGTAAAACGACGAGCTCGATGAGTGAGCGGAGCATAAAAGCACGGCTTGCTCCTCTCTCAAGC
AGGTATCTTGGTCGTTTTTTTTTTTTTTGGCGAACCTAGATGCGACCTGCACAATGACAAGCAACCAGATTAAAG
TCATTGCGCTATGCTCGGTGGGAAACCTCGGCAAATATGTCTGCGATGCATTGCTTGCCGACGGCCGCTATCAAT
TTGTCGTAATCTCTCGGCAGGTAAGTAAGTCCACGTCGTGTAGGACTGGTTTCTGGCCCGATACATGTACTGACC
AGATCGACCAAGTCCAAGAAAGGGGCCTTCTTCGAGCAACGTGGTATAAATGTGCGCGTCAGTGATTACAGCACG
GATTCCGTCCTCCAGATCTTGAACGAGACGAATGCCAGTGCTTTGATATCATTCAACAATAGCGATGGCCAGACC
TTCGTCGATGTGCACAGCGCCTTCCTGGAAGCTTGTCGCAAGTCGAAGAACTGCAAGCGGTTCATACCCTCAGAA
TTCGCTGGCAATATTGATGATTTTCCACTGCATCCCAGCTATTTCAAAACGTCACGGGTGCCGTTTCGCAAGATT
CTTGAACAAGAGTCGGATGTGGAGTGGACGATATTCAACAACGGTTGGTTGATGGACTACTTCTTGACCGAAGAG
AAATCGTACATGCCTTCCATCCCGAATGAATTTCCAATTGATCCAAACAACTGGAGGGCGTGTATCCGGGGTTCT
GGTAATGAGGTGCAGTCTTTCACAAGTGGTCGAGACGTCGCGAAAGCGCTCATTGCGCTGCTCAGCGCGGCGGAA
TGGGTGAGATCCCCTCCCACCGAGACTTTTGATGAGTGGCTGCTTACACGACATGTAGGAGCGCACGACGTACAT
CACCGGCCAATGGTCGACCTTTAACGAAATGTTGCGAGCCATGGAAGAATTCTACGGTTCGTGCAACTTTGCTCA
TTCCATCACGTCACCGACTGACAAGTGGTGTAGGCCGACCGATGGACAAGACTTACAAGTCTGAGGAGGATATCC
ATCGCGACACTTTGCTGCCTCCTACAGCCGAAAATCTGGAGGCACTCTATCTTTCAAGCGTAGAGGAGATGATGA
TAACGGCTTCAGGCGCCTGTCCTCGTGAAAAGACCATGAATCAGCGCGACAAGTTCTTCCCTAGCATTCGTTTTT
TAACGCTTGAGGAGCTCCTGTTGCAGACAGGGTCTACAAGGTCAAAGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail