Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7664
Gene name
LocationContig_459:13120..15164
Strand-
Gene length (bp)2044
Transcript length (bp)1815
Coding sequence length (bp)1815
Protein length (aa) 605

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00854 PTR2 POT family 2.1E-52 153 559

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P380|PTR2_SCHPO Probable peptide transporter ptr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr2 PE=1 SV=1 1 602 2.0E-69
sp|P32901|PTR2_YEAST Peptide transporter PTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTR2 PE=1 SV=2 27 604 4.0E-68
sp|P46030|PTR2_CANAX Peptide transporter PTR2 OS=Candida albicans GN=PTR2 PE=3 SV=1 1 595 1.0E-34
sp|Q68F72|S15A4_XENLA Solute carrier family 15 member 4 OS=Xenopus laevis GN=slc15a4 PE=2 SV=1 87 563 2.0E-27
sp|Q8WMX5|S15A1_CANLF Solute carrier family 15 member 1 OS=Canis lupus familiaris GN=SLC15A1 PE=2 SV=2 72 485 4.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P380|PTR2_SCHPO Probable peptide transporter ptr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr2 PE=1 SV=1 1 602 2.0E-69
sp|P32901|PTR2_YEAST Peptide transporter PTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTR2 PE=1 SV=2 27 604 4.0E-68
sp|P46030|PTR2_CANAX Peptide transporter PTR2 OS=Candida albicans GN=PTR2 PE=3 SV=1 1 595 1.0E-34
sp|Q68F72|S15A4_XENLA Solute carrier family 15 member 4 OS=Xenopus laevis GN=slc15a4 PE=2 SV=1 87 563 2.0E-27
sp|Q8WMX5|S15A1_CANLF Solute carrier family 15 member 1 OS=Canis lupus familiaris GN=SLC15A1 PE=2 SV=2 72 485 4.0E-27
sp|P51574|S15A1_RAT Solute carrier family 15 member 1 OS=Rattus norvegicus GN=Slc15a1 PE=2 SV=1 72 485 3.0E-26
sp|Q9JIP7|S15A1_MOUSE Solute carrier family 15 member 1 OS=Mus musculus GN=Slc15a1 PE=1 SV=2 72 497 8.0E-25
sp|P36836|S15A1_RABIT Solute carrier family 15 member 1 OS=Oryctolagus cuniculus GN=SLC15A1 PE=2 SV=1 72 497 3.0E-24
sp|P46059|S15A1_HUMAN Solute carrier family 15 member 1 OS=Homo sapiens GN=SLC15A1 PE=2 SV=1 122 485 3.0E-23
sp|Q8N697|S15A4_HUMAN Solute carrier family 15 member 4 OS=Homo sapiens GN=SLC15A4 PE=2 SV=1 256 600 9.0E-23
sp|O09014|S15A4_RAT Solute carrier family 15 member 4 OS=Rattus norvegicus GN=Slc15a4 PE=1 SV=1 256 537 3.0E-22
sp|Q91W98|S15A4_MOUSE Solute carrier family 15 member 4 OS=Mus musculus GN=Slc15a4 PE=1 SV=1 256 537 4.0E-21
sp|A6QQL0|S15A4_BOVIN Solute carrier family 15 member 4 OS=Bos taurus GN=SLC15A4 PE=2 SV=2 256 537 9.0E-21
sp|Q9M390|PTR1_ARATH Protein NRT1/ PTR FAMILY 8.1 OS=Arabidopsis thaliana GN=NPF8.1 PE=1 SV=1 40 589 4.0E-19
sp|Q9LFB8|PTR5_ARATH Protein NRT1/ PTR FAMILY 8.2 OS=Arabidopsis thaliana GN=NPF8.2 PE=2 SV=1 80 557 2.0E-17
sp|Q93Z20|PTR17_ARATH Protein NRT1/ PTR FAMILY 8.5 OS=Arabidopsis thaliana GN=NPF8.5 PE=2 SV=1 52 555 3.0E-16
sp|P46032|PTR2_ARATH Protein NRT1/ PTR FAMILY 8.3 OS=Arabidopsis thaliana GN=NPF8.3 PE=1 SV=1 52 555 8.0E-16
sp|Q84WG0|PTR26_ARATH Protein NRT1/ PTR FAMILY 8.4 OS=Arabidopsis thaliana GN=NPF8.4 PE=2 SV=2 36 536 2.0E-15
sp|Q63424|S15A2_RAT Solute carrier family 15 member 2 OS=Rattus norvegicus GN=Slc15a2 PE=1 SV=1 72 478 5.0E-15
sp|P91679|PEPT1_DROME Peptide transporter family 1 OS=Drosophila melanogaster GN=yin PE=1 SV=2 43 448 7.0E-15
sp|P46029|S15A2_RABIT Solute carrier family 15 member 2 OS=Oryctolagus cuniculus GN=SLC15A2 PE=2 SV=1 56 492 1.0E-14
sp|Q8BPX9|S15A3_MOUSE Solute carrier family 15 member 3 OS=Mus musculus GN=Slc15a3 PE=2 SV=1 256 548 6.0E-14
sp|Q16348|S15A2_HUMAN Solute carrier family 15 member 2 OS=Homo sapiens GN=SLC15A2 PE=2 SV=2 72 462 7.0E-14
sp|Q924V4|S15A3_RAT Solute carrier family 15 member 3 OS=Rattus norvegicus GN=Slc15a3 PE=2 SV=1 256 548 9.0E-14
sp|Q9ES07|S15A2_MOUSE Solute carrier family 15 member 2 OS=Mus musculus GN=Slc15a2 PE=1 SV=1 72 475 9.0E-14
sp|Q8IY34|S15A3_HUMAN Solute carrier family 15 member 3 OS=Homo sapiens GN=SLC15A3 PE=2 SV=2 256 548 3.0E-12
sp|Q17758|PEPT2_CAEEL Peptide transporter family 2 OS=Caenorhabditis elegans GN=pept-2 PE=1 SV=2 79 484 9.0E-12
sp|Q9LQL2|PTR14_ARATH Protein NRT1/ PTR FAMILY 7.3 OS=Arabidopsis thaliana GN=NPF7.3 PE=1 SV=2 258 561 9.0E-12
sp|Q0WSZ6|PTR23_ARATH Protein NRT1/ PTR FAMILY 5.13 OS=Arabidopsis thaliana GN=NPF5.13 PE=2 SV=2 77 537 3.0E-11
sp|Q9LFR1|PTR50_ARATH Protein NRT1/ PTR FAMILY 5.8 OS=Arabidopsis thaliana GN=NPF5.8 PE=2 SV=1 80 603 8.0E-11
sp|Q21219|PEPT1_CAEEL Peptide transporter family 1 OS=Caenorhabditis elegans GN=pept-1 PE=2 SV=2 72 501 2.0E-09
sp|Q9M9V7|PTR8_ARATH Protein NRT1/ PTR FAMILY 2.9 OS=Arabidopsis thaliana GN=NPF2.9 PE=1 SV=1 255 558 3.0E-09
sp|Q8RX67|PTR24_ARATH Protein NRT1/ PTR FAMILY 5.11 OS=Arabidopsis thaliana GN=NPF5.11 PE=2 SV=1 75 538 6.0E-09
sp|Q0WP01|PTR9_ARATH Protein NRT1/ PTR FAMILY 5.10 OS=Arabidopsis thaliana GN=NPF5.10 PE=2 SV=1 372 532 6.0E-09
sp|Q9M817|PTR6_ARATH Protein NRT1/ PTR FAMILY 1.2 OS=Arabidopsis thaliana GN=NPF1.2 PE=1 SV=1 133 553 1.0E-08
sp|Q3E9B5|PTR51_ARATH Protein NRT1/ PTR FAMILY 7.1 OS=Arabidopsis thaliana GN=NPF7.1 PE=2 SV=1 348 557 1.0E-08
sp|Q9C7U1|PTR25_ARATH Protein NRT1/ PTR FAMILY 5.12 OS=Arabidopsis thaliana GN=NPF5.12 PE=2 SV=1 63 579 2.0E-08
sp|Q8GXN2|PTR47_ARATH Protein NRT1/ PTR FAMILY 7.2 OS=Arabidopsis thaliana GN=NPF7.2 PE=2 SV=2 258 556 5.0E-08
sp|Q8VZE2|PTR22_ARATH Protein NRT1/ PTR FAMILY 5.14 OS=Arabidopsis thaliana GN=NPF5.14 PE=2 SV=2 427 532 7.0E-08
sp|Q9SK96|PTR10_ARATH Protein NRT1/ PTR FAMILY 5.16 OS=Arabidopsis thaliana GN=NPF5.16 PE=2 SV=1 51 548 2.0E-07
sp|Q56XQ6|PTR15_ARATH Protein NRT1/ PTR FAMILY 4.4 OS=Arabidopsis thaliana GN=NPF4.4 PE=2 SV=1 427 537 4.0E-07
sp|Q21219|PEPT1_CAEEL Peptide transporter family 1 OS=Caenorhabditis elegans GN=pept-1 PE=2 SV=2 476 582 7.0E-07
sp|Q93VV5|PTR16_ARATH Protein NRT1/ PTR FAMILY 4.3 OS=Arabidopsis thaliana GN=NPF4.3 PE=2 SV=1 373 537 4.0E-06
sp|P91679|PEPT1_DROME Peptide transporter family 1 OS=Drosophila melanogaster GN=yin PE=1 SV=2 495 596 5.0E-06
sp|Q9SZY4|PTR27_ARATH Protein NRT1/ PTR FAMILY 6.2 OS=Arabidopsis thaliana GN=NPF6.2 PE=1 SV=1 293 537 5.0E-06
sp|Q63424|S15A2_RAT Solute carrier family 15 member 2 OS=Rattus norvegicus GN=Slc15a2 PE=1 SV=1 493 598 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 122 144 22
2 151 173 22
3 186 208 22
4 258 280 22
5 285 307 22
6 457 479 22
7 499 521 22
8 533 555 22
9 560 582 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7664
MSSVEVELEHQAASQVKLQCPATVVSAQSSAGFSAESSAERETDTEAGTGDEDGARSPHAVAGSPGVKRVPYPIT
TAGWIVIAVGSLERMAFYGGSTPFQNYIQRSGGPGHPGRLGKGQVAATALNQYFYFLSYLTPVMASAICDSVSGK
YGVILASSVAGIAGWGLMAGTSVPSVSVDGALAGLVVGMAAVAASSGGVSSIIPAFAVDQARGKGMTVASPSSPT
LRGRLLGRLLGRRPGRPAATKVVYDSSLNVQHIFHWYYLYINAVGLVGSVATPFIEIYSSYLAVFMFATGSIALG
TAVLMLGKPTFKMVKPQQGLVSDCLRSVRLSLSERKRSRPGGLACGHFLDRSKASYQTALYGADGHGVADQTVED
LKRALDTLRILPPLAVFWLAFNQCSHNLLSQASQMRRPSWLSNDLMTNANPIALTVFVPVLDHYGFPWLRKKGWE
PTPIKRMTIGFLLASLGMVYAAVLQAFIYRSAPYFDHPGDRSNDISVWWQLPPYTIVALAEIFAVITALEYAYSR
SPTSMKTFVSAMNAVPNAAASLLVYVLLPLNRDPYLTWNFATIALLAFATTVVFWLLFRGEDKEWKSEADDKHRD
ALNL*
Coding >Hirsu2|7664
ATGAGCAGCGTCGAGGTCGAGCTCGAGCACCAGGCGGCCTCGCAGGTCAAGCTCCAGTGCCCGGCCACGGTCGTC
AGCGCGCAGTCGAGCGCCGGCTTTTCCGCCGAGAGCTCGGCCGAGCGCGAAACGGACACCGAGGCCGGCACCGGC
GACGAGGATGGCGCCCGGTCGCCGCACGCCGTGGCCGGCAGCCCGGGCGTCAAGCGGGTTCCGTACCCGATCACG
ACGGCCGGCTGGATCGTCATCGCCGTCGGCTCGCTGGAGAGGATGGCCTTCTACGGCGGGAGCACGCCCTTCCAG
AACTACATCCAGCGCAGCGGCGGCCCGGGCCATCCCGGCCGCCTGGGCAAGGGACAGGTGGCGGCCACGGCCCTG
AACCAGTACTTCTACTTCCTGAGCTACCTGACCCCTGTCATGGCCTCGGCCATCTGTGACAGCGTGTCCGGCAAG
TACGGCGTCATCCTGGCCTCGTCCGTCGCCGGCATCGCCGGCTGGGGCCTCATGGCCGGCACCTCGGTCCCGTCC
GTCTCGGTCGACGGCGCGCTGGCCGGCCTGGTGGTCGGCATGGCGGCGGTGGCGGCCAGCTCCGGAGGCGTGAGC
TCCATCATCCCCGCCTTCGCCGTCGACCAGGCGCGCGGCAAGGGCATGACGGTCGCCTCGCCGTCGAGCCCGACG
CTGCGGGGCCGTCTGCTCGGCCGCCTGCTCGGCCGCCGGCCGGGCCGGCCGGCCGCGACCAAGGTCGTGTACGAC
TCGTCGCTGAACGTCCAGCACATCTTCCACTGGTACTACCTCTACATCAACGCCGTCGGGCTGGTCGGCTCGGTC
GCGACGCCCTTCATCGAGATCTACTCGTCCTACCTGGCCGTCTTCATGTTCGCCACGGGCTCCATCGCCCTCGGC
ACGGCCGTGCTCATGCTGGGCAAGCCGACCTTCAAGATGGTCAAGCCGCAGCAGGGGCTTGTGAGCGACTGCCTG
CGCTCCGTCCGACTCTCGCTGTCCGAGCGCAAGAGGAGCCGGCCCGGCGGCCTCGCGTGCGGCCACTTCCTGGAC
CGGTCCAAGGCCAGCTACCAGACGGCCCTGTACGGCGCCGACGGCCACGGCGTCGCCGACCAGACGGTCGAGGAC
CTCAAGCGGGCCCTGGACACGCTGCGCATCTTGCCGCCGCTCGCCGTCTTCTGGCTCGCCTTCAACCAGTGCTCC
CACAACCTGCTGTCCCAGGCGAGCCAGATGCGCCGGCCGTCGTGGCTGAGCAACGACCTGATGACCAACGCGAAC
CCGATCGCGCTCACCGTCTTCGTCCCCGTCCTCGACCACTACGGCTTCCCCTGGCTGAGGAAGAAGGGCTGGGAG
CCGACGCCGATCAAGCGGATGACCATCGGCTTCCTGCTGGCCTCGCTGGGCATGGTCTATGCCGCCGTGCTGCAG
GCCTTCATCTACCGCTCCGCGCCATACTTTGACCACCCGGGGGACCGCTCCAACGACATCAGCGTCTGGTGGCAG
CTGCCGCCATACACCATCGTGGCGCTGGCCGAGATCTTCGCCGTCATAACCGCCCTCGAGTACGCCTACAGTCGC
TCCCCGACCTCCATGAAGACGTTCGTGTCGGCGATGAATGCCGTTCCCAACGCGGCCGCCTCTCTTCTCGTCTAC
GTCCTGCTCCCGCTCAACCGAGACCCCTACCTCACCTGGAACTTCGCGACGATTGCATTACTCGCGTTTGCGACA
ACCGTGGTCTTCTGGCTGCTGTTCCGAGGGGAGGATAAAGAGTGGAAATCCGAAGCCGACGATAAGCACCGCGAT
GCGCTTAACCTGTGA
Transcript >Hirsu2|7664
ATGAGCAGCGTCGAGGTCGAGCTCGAGCACCAGGCGGCCTCGCAGGTCAAGCTCCAGTGCCCGGCCACGGTCGTC
AGCGCGCAGTCGAGCGCCGGCTTTTCCGCCGAGAGCTCGGCCGAGCGCGAAACGGACACCGAGGCCGGCACCGGC
GACGAGGATGGCGCCCGGTCGCCGCACGCCGTGGCCGGCAGCCCGGGCGTCAAGCGGGTTCCGTACCCGATCACG
ACGGCCGGCTGGATCGTCATCGCCGTCGGCTCGCTGGAGAGGATGGCCTTCTACGGCGGGAGCACGCCCTTCCAG
AACTACATCCAGCGCAGCGGCGGCCCGGGCCATCCCGGCCGCCTGGGCAAGGGACAGGTGGCGGCCACGGCCCTG
AACCAGTACTTCTACTTCCTGAGCTACCTGACCCCTGTCATGGCCTCGGCCATCTGTGACAGCGTGTCCGGCAAG
TACGGCGTCATCCTGGCCTCGTCCGTCGCCGGCATCGCCGGCTGGGGCCTCATGGCCGGCACCTCGGTCCCGTCC
GTCTCGGTCGACGGCGCGCTGGCCGGCCTGGTGGTCGGCATGGCGGCGGTGGCGGCCAGCTCCGGAGGCGTGAGC
TCCATCATCCCCGCCTTCGCCGTCGACCAGGCGCGCGGCAAGGGCATGACGGTCGCCTCGCCGTCGAGCCCGACG
CTGCGGGGCCGTCTGCTCGGCCGCCTGCTCGGCCGCCGGCCGGGCCGGCCGGCCGCGACCAAGGTCGTGTACGAC
TCGTCGCTGAACGTCCAGCACATCTTCCACTGGTACTACCTCTACATCAACGCCGTCGGGCTGGTCGGCTCGGTC
GCGACGCCCTTCATCGAGATCTACTCGTCCTACCTGGCCGTCTTCATGTTCGCCACGGGCTCCATCGCCCTCGGC
ACGGCCGTGCTCATGCTGGGCAAGCCGACCTTCAAGATGGTCAAGCCGCAGCAGGGGCTTGTGAGCGACTGCCTG
CGCTCCGTCCGACTCTCGCTGTCCGAGCGCAAGAGGAGCCGGCCCGGCGGCCTCGCGTGCGGCCACTTCCTGGAC
CGGTCCAAGGCCAGCTACCAGACGGCCCTGTACGGCGCCGACGGCCACGGCGTCGCCGACCAGACGGTCGAGGAC
CTCAAGCGGGCCCTGGACACGCTGCGCATCTTGCCGCCGCTCGCCGTCTTCTGGCTCGCCTTCAACCAGTGCTCC
CACAACCTGCTGTCCCAGGCGAGCCAGATGCGCCGGCCGTCGTGGCTGAGCAACGACCTGATGACCAACGCGAAC
CCGATCGCGCTCACCGTCTTCGTCCCCGTCCTCGACCACTACGGCTTCCCCTGGCTGAGGAAGAAGGGCTGGGAG
CCGACGCCGATCAAGCGGATGACCATCGGCTTCCTGCTGGCCTCGCTGGGCATGGTCTATGCCGCCGTGCTGCAG
GCCTTCATCTACCGCTCCGCGCCATACTTTGACCACCCGGGGGACCGCTCCAACGACATCAGCGTCTGGTGGCAG
CTGCCGCCATACACCATCGTGGCGCTGGCCGAGATCTTCGCCGTCATAACCGCCCTCGAGTACGCCTACAGTCGC
TCCCCGACCTCCATGAAGACGTTCGTGTCGGCGATGAATGCCGTTCCCAACGCGGCCGCCTCTCTTCTCGTCTAC
GTCCTGCTCCCGCTCAACCGAGACCCCTACCTCACCTGGAACTTCGCGACGATTGCATTACTCGCGTTTGCGACA
ACCGTGGTCTTCTGGCTGCTGTTCCGAGGGGAGGATAAAGAGTGGAAATCCGAAGCCGACGATAAGCACCGCGAT
GCGCTTAACCTGTGA
Gene >Hirsu2|7664
ATGAGCAGCGTCGAGGTCGAGCTCGAGCACCAGGCGGCCTCGCAGGTCAAGCTCCAGTGCCCGGCCACGGTCGTC
AGCGCGCAGTCGAGCGCCGGCTTTTCCGCCGAGAGCTCGGCCGAGCGCGAAACGGACACCGAGGCCGGCACCGGC
GACGAGGATGGCGCCCGGTCGCCGCACGCCGTGGCCGGCAGCCCGGGCGTCAAGCGGGTTCCGTACCCGATCACG
ACGGCCGGCTGGATCGTCATCGCCGTCGGCTCGCTGGAGAGGATGGCCTTCTACGGCGGGAGCACGCCCTTCCAG
AACTACATCCAGCGCAGCGGCGGCCCGGGCCATCCCGGCCGCCTGGGCAAGGGACAGGTGGCGGCCACGGCCCTG
AACCAGTACTTGTGAGTCCGGCGCGGTCGAGGCCTTTGCTGACCGGTTTGGGCCGGCTCGGGCGCTGCTGGCTGA
CGATGATACGATGCTGATGACGGACAGCTACTTCCTGAGCTACCTGACCCCTGTCATGGCCTCGGCCATCTGTGA
CAGCGTGTCCGGCAAGTACGGCGTCATCCTGGCCTCGTCCGTCGCCGGCATCGCCGGCTGGGGCCTCATGGCCGG
CACCTCGGTCCCGTCCGTCTCGGTCGACGGCGCGCTGGCCGGCCTGGTGGTCGGCATGGCGGCGGTGGCGGCCAG
CTCCGGAGGCGTGAGCTCCATCATCCCCGCCTTCGCCGTCGACCAGGCGCGCGGCAAGGGCATGACGGTCGCCTC
GCCGTCGAGCCCGACGCTGCGGGGCCGTCTGCTCGGCCGCCTGCTCGGCCGCCGGCCGGGCCGGCCGGCCGCGAC
CAAGGTCGTGTACGACTCGTCGCTGAACGTCCAGCACATCTTCCACTGGTACTACCTCTACATCAACGCCGTCGG
GCTGGTCGGCTCGGTCGCGACGCCCTTCATCGAGATCTACTCGTCCTACCTGGCCGTCTTCATGTTCGCCACGGG
CTCCATCGCCCTCGGCACGGCCGTGCTCATGCTGGGCAAGCCGACCTTCAAGATGGTCAAGCCGCAGCAGGGGCT
TGTGAGCGACTGCCTGCGCTCCGTCCGACTCTCGCTGTCCGAGCGCAAGAGGAGCCGGCCCGGCGGCCTCGCGTG
CGGCCACTTCCTGGACCGGTCCAAGGCCAGCTACCAGACGGCCCTGTACGGCGCCGACGGCCACGGCGTCGCCGA
CCAGACGGTCGAGGACCTCAAGCGGGCCCTGGACACGCTGCGCATCTTGCCGCCGCTCGCCGTCTTCTGGCTCGC
CTTCAACCAGTGCTCCCACAACCTGCTGTCCCAGGCGAGCCAGATGCGCCGGCCGTCGTGGCTGAGCAACGACCT
GATGACCAACGCGAACCCGATCGCGCTCACCGTCTTCGTCCCCGTCCTCGACCACTACGGCTTCCCCTGGCTGAG
GAAGAAGGGCTGGGAGCCGACGCCGATCAAGCGGATGACCATCGGCTTCCTGCTGGCCTCGCTGGGCATGGTCTA
TGCCGCCGTGCTGCAGGCCTTCATCTACCGCTCCGCGCCATACTTTGACCACCCGGGGGACCGCTCCAACGACAT
CAGCGTCTGGTGGCAGCTGCCGCCATACACCATCGTGGCGCTGGCCGAGATCTTGTAAGTGCCTTGCTGTGCTCT
CTCGGTGAAGGAGGATGTGTAGCTGAGACCGGCGTTCCACAACGGATCAGCGCCGTCATAACCGCCCTCGAGTAC
GCCTACAGTCGCTCCCCGACCTCCATGAAGACGTTCGTGTCGGCGATGAATGCCGTTCCCAACGCGGCCGCCTCT
CTTCTCGTCTACGTCCTGCTCCCGCTCAACCGAGACCCCTACCTCACCTGGAACTTCGCGACGATTGCATGTGAG
TAGCGACCTGCCCGCCCGCGAGACCGGACTCAAGACGGCGGCTTACGTGGTTTGTATGGCAGTACTCGCGTTTGC
GACAACCGTGGTCTTCTGGCTGCTGTTCCGAGGGGAGGATAAAGAGTGGAAATCCGAAGCCGACGATAAGCACCG
CGATGCGCTTAACCTGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail