Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7663
Gene name
LocationContig_459:5583..11459
Strand-
Gene length (bp)5876
Transcript length (bp)5673
Coding sequence length (bp)5673
Protein length (aa) 1891

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 2.0E-71 19 439
PF00501 AMP-binding AMP-binding enzyme 2.1E-56 1115 1518
PF00668 Condensation Condensation domain 7.3E-43 644 1068
PF13847 Methyltransf_31 Methyltransferase domain 1.7E-13 1649 1761
PF08242 Methyltransf_12 Methyltransferase domain 1.0E-13 1653 1752
PF13649 Methyltransf_25 Methyltransferase domain 1.6E-12 1651 1750
PF08241 Methyltransf_11 Methyltransferase domain 1.4E-11 1653 1754
PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain 1.1E-08 449 524
PF13489 Methyltransf_23 Methyltransferase domain 6.0E-09 1627 1757
PF00550 PP-binding Phosphopantetheine attachment site 9.2E-09 557 622
PF05175 MTS Methyltransferase small domain 1.7E-05 1642 1773
PF05401 NodS Nodulation protein S (NodS) 1.0E-04 1637 1764

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 11 1557 1.0E-131
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 11 1559 4.0E-129
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 11 1546 7.0E-126
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 10 1555 1.0E-125
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 11 1552 4.0E-125
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 11 1557 1.0E-131
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 11 1559 4.0E-129
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 11 1546 7.0E-126
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 10 1555 1.0E-125
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 11 1552 4.0E-125
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 13 1570 1.0E-124
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 10 1555 4.0E-124
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 13 1581 8.0E-124
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 11 1551 9.0E-123
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 16 1552 9.0E-123
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 11 1567 1.0E-122
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 11 1572 1.0E-121
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 13 1564 2.0E-120
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 11 1567 1.0E-119
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 13 1568 1.0E-119
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 36 1590 1.0E-118
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 13 1553 4.0E-118
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 8 1578 2.0E-117
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 13 1551 1.0E-116
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 13 1552 3.0E-115
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 13 1577 3.0E-115
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 13 1556 2.0E-114
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 11 1558 6.0E-114
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 11 1557 7.0E-114
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 9 1557 8.0E-114
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 13 1531 9.0E-114
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 9 1557 2.0E-113
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 70 1572 2.0E-113
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 13 1567 5.0E-111
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 11 1570 5.0E-109
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 9 1556 5.0E-109
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 13 1546 1.0E-108
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 15 1551 8.0E-104
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 1 1547 8.0E-104
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 7 1571 2.0E-100
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 6 1569 9.0E-100
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 13 1555 1.0E-99
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 19 1570 7.0E-99
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 66 1840 3.0E-97
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 9 1558 7.0E-97
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 9 1558 7.0E-97
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 9 1564 9.0E-94
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 11 1546 6.0E-93
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 644 1840 5.0E-88
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 11 1546 2.0E-85
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 11 1567 3.0E-84
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 13 1063 6.0E-83
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 11 1100 6.0E-82
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 72 1064 4.0E-80
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 11 1579 2.0E-76
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 11 1566 1.0E-75
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 16 1546 4.0E-75
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 11 1566 2.0E-74
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 11 1559 8.0E-72
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 70 1537 3.0E-69
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 11 961 9.0E-67
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 19 1074 1.0E-66
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 7 1063 1.0E-66
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3 1531 2.0E-66
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 13 1077 8.0E-66
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 15 993 1.0E-65
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 19 1066 1.0E-65
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 11 804 1.0E-65
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 16 963 2.0E-65
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 11 805 2.0E-65
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 11 963 1.0E-64
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 13 820 3.0E-64
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 7 1531 6.0E-64
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 13 1066 2.0E-63
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 11 649 5.0E-62
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 15 958 3.0E-61
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 13 673 4.0E-61
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 70 1531 5.0E-61
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 15 1066 2.0E-60
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 11 804 2.0E-60
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 13 842 3.0E-60
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 551 1553 4.0E-60
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 11 937 4.0E-59
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 5 801 6.0E-59
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 11 642 2.0E-58
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 25 1535 2.0E-58
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 25 1531 5.0E-58
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 11 642 6.0E-58
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 9 878 8.0E-58
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 25 1535 1.0E-57
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 9 623 2.0E-57
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 11 1066 3.0E-57
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 643 1558 2.0E-56
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 16 816 6.0E-56
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 13 650 2.0E-55
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 15 1546 5.0E-55
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 24 657 6.0E-54
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 7 964 2.0E-53
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 11 807 2.0E-53
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 13 792 4.0E-53
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 20 805 2.0E-52
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 13 803 4.0E-51
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 13 595 5.0E-51
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 66 972 1.0E-50
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 642 1567 2.0E-50
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 11 645 3.0E-50
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 13 819 9.0E-50
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 70 732 1.0E-49
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 17 991 1.0E-49
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 13 631 3.0E-49
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 640 1552 6.0E-49
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 69 667 3.0E-48
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 645 1567 9.0E-48
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3 803 1.0E-47
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 5 716 1.0E-47
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 11 703 2.0E-47
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 25 805 3.0E-47
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 11 703 3.0E-47
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 12 942 4.0E-47
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 647 1528 2.0E-46
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 642 1566 5.0E-46
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 19 516 6.0E-46
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 173 1539 6.0E-46
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 17 1064 7.0E-46
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 641 1547 1.0E-45
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 784 1559 3.0E-45
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 13 842 4.0E-45
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 70 939 5.0E-45
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 70 939 6.0E-45
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 638 1580 2.0E-44
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 17 632 2.0E-44
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 1177 1840 2.0E-44
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 9 622 6.0E-44
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 749 1563 1.0E-43
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 644 1568 5.0E-43
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 642 1531 7.0E-43
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 25 804 1.0E-42
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 64 989 1.0E-42
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 70 623 1.0E-42
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 644 1568 3.0E-42
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 640 1552 4.0E-42
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 24 940 4.0E-42
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 22 805 7.0E-41
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 70 710 8.0E-41
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 637 1553 1.0E-40
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 644 1538 1.0E-40
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 644 1570 1.0E-40
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 13 655 1.0E-40
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 66 989 2.0E-40
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 13 565 4.0E-40
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 13 565 4.0E-40
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 642 1553 2.0E-39
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 642 1567 2.0E-39
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 644 1546 2.0E-39
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 9 629 2.0E-39
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 9 629 5.0E-39
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 13 624 5.0E-39
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 13 1531 9.0E-39
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 749 1552 2.0E-38
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 13 974 2.0E-38
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 6 555 2.0E-38
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 9 629 2.0E-38
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 13 629 4.0E-38
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 671 1565 5.0E-38
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 13 629 5.0E-38
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 13 629 5.0E-38
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 13 596 8.0E-38
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 13 592 1.0E-37
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 5 629 4.0E-37
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 642 1551 8.0E-37
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 20 886 2.0E-36
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 647 1575 2.0E-36
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 779 1567 6.0E-36
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 64 801 1.0E-35
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 79 533 1.0E-35
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 749 1566 2.0E-35
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 12 533 2.0E-35
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 47 531 2.0E-35
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 11 530 3.0E-35
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 13 623 4.0E-35
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 784 1567 1.0E-34
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 13 716 8.0E-34
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1114 1559 2.0E-33
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 13 691 3.0E-33
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 1114 1552 4.0E-33
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 19 533 8.0E-33
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 12 533 1.0E-32
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 19 533 2.0E-32
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 651 1557 3.0E-32
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 9 599 3.0E-32
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 21 533 3.0E-32
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1110 1554 5.0E-32
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 82 645 6.0E-32
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 13 624 9.0E-32
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 19 533 2.0E-31
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 90 537 3.0E-31
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 90 537 3.0E-31
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 90 537 3.0E-31
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 90 537 3.0E-31
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 90 537 3.0E-31
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 12 533 3.0E-31
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 90 537 4.0E-31
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 90 537 4.0E-31
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 90 537 4.0E-31
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 90 537 4.0E-31
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 90 537 5.0E-31
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 90 537 5.0E-31
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 10 533 5.0E-31
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 10 533 5.0E-31
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 174 537 7.0E-31
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 21 533 8.0E-31
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 1078 1555 9.0E-31
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 1078 1555 9.0E-31
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 1124 1542 1.0E-30
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 10 533 1.0E-30
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 10 533 1.0E-30
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 10 533 1.0E-30
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 21 533 1.0E-30
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 10 533 2.0E-30
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 130 640 2.0E-30
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 70 640 2.0E-30
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 10 533 3.0E-30
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 10 533 3.0E-30
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 10 533 3.0E-30
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 10 533 3.0E-30
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 21 533 3.0E-30
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 10 533 3.0E-30
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 19 667 4.0E-30
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 10 533 4.0E-30
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 10 533 4.0E-30
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 10 533 4.0E-30
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 10 533 5.0E-30
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 13 651 8.0E-30
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 21 533 1.0E-29
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 81 533 1.0E-29
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 13 619 1.0E-29
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 174 537 1.0E-29
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 174 537 1.0E-29
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 174 537 1.0E-29
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 174 537 1.0E-29
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 21 533 2.0E-29
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1126 1553 5.0E-29
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 81 531 6.0E-29
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 172 537 6.0E-29
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 81 531 1.0E-28
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 81 531 1.0E-28
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 81 531 1.0E-28
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 81 531 1.0E-28
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 81 531 1.0E-28
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 81 531 1.0E-28
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 81 531 1.0E-28
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 81 531 1.0E-28
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 174 537 2.0E-28
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 174 537 2.0E-28
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 81 531 2.0E-28
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 81 531 2.0E-28
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 81 531 2.0E-28
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 81 531 2.0E-28
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 81 531 2.0E-28
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 81 531 2.0E-28
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 174 533 2.0E-28
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 174 533 3.0E-28
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 174 533 3.0E-28
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 174 537 3.0E-28
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 1127 1546 4.0E-28
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 81 531 4.0E-28
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 1110 1546 8.0E-28
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 13 542 2.0E-27
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 20 480 2.0E-26
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 1118 1567 2.0E-26
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 81 531 3.0E-26
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 81 531 4.0E-26
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 909 1567 1.0E-25
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 173 611 1.0E-25
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 64 587 5.0E-25
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 1127 1544 2.0E-24
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 909 1567 2.0E-24
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 1121 1546 2.0E-24
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 1121 1546 3.0E-24
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 13 596 3.0E-24
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 1121 1546 4.0E-24
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1031 1560 8.0E-24
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 1105 1567 1.0E-23
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 10 530 1.0E-23
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 1121 1546 2.0E-23
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1030 1542 3.0E-23
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1030 1542 4.0E-23
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 1121 1546 4.0E-23
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 10 531 6.0E-23
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 561 1531 8.0E-23
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 177 604 9.0E-23
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 623 1535 2.0E-22
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 1107 1531 2.0E-22
sp|Q8H151|AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 70 530 3.0E-22
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 1104 1531 4.0E-22
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 1105 1531 4.0E-22
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 1105 1531 4.0E-22
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 1105 1531 4.0E-22
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 1110 1546 5.0E-22
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 1104 1531 8.0E-22
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 1110 1575 9.0E-22
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 1104 1555 2.0E-21
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 1126 1531 2.0E-21
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 1126 1531 2.0E-21
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 1105 1531 2.0E-21
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 1105 1531 2.0E-21
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 1105 1531 2.0E-21
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 1105 1531 2.0E-21
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 1105 1531 3.0E-21
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 1105 1531 4.0E-21
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 1126 1531 4.0E-21
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1128 1579 5.0E-21
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 1105 1531 5.0E-21
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 170 530 5.0E-21
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 1126 1531 6.0E-21
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 17 459 7.0E-21
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 1105 1531 7.0E-21
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 1124 1579 8.0E-21
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 1124 1579 8.0E-21
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 24 531 8.0E-21
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1120 1540 1.0E-20
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 1124 1579 1.0E-20
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 1124 1579 1.0E-20
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 1124 1579 1.0E-20
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 1124 1579 1.0E-20
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 1124 1579 1.0E-20
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 1124 1579 1.0E-20
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 1124 1579 1.0E-20
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 1124 1579 1.0E-20
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 886 1567 1.0E-20
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 1121 1546 3.0E-20
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 1128 1591 3.0E-20
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 1128 1591 3.0E-20
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 13 619 3.0E-20
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 1123 1567 4.0E-20
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 1128 1579 4.0E-20
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 1128 1591 4.0E-20
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1110 1596 5.0E-20
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 86 480 9.0E-20
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1110 1559 1.0E-19
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 172 539 2.0E-19
sp|Q4G176|ACSF3_HUMAN Acyl-CoA synthetase family member 3, mitochondrial OS=Homo sapiens GN=ACSF3 PE=1 SV=3 17 535 3.0E-19
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 152 539 4.0E-19
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 1119 1594 6.0E-19
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1126 1531 8.0E-19
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1112 1544 1.0E-18
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 1126 1531 1.0E-18
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 1119 1594 1.0E-18
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 1119 1594 1.0E-18
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 1119 1594 1.0E-18
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 1119 1594 1.0E-18
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 132 530 3.0E-18
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 1119 1594 4.0E-18
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 1119 1594 4.0E-18
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 18 530 4.0E-18
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 173 666 5.0E-18
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1127 1546 6.0E-18
sp|P59871|ACSA_MYCBO Acetyl-coenzyme A synthetase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=acsA PE=3 SV=1 136 530 7.0E-18
sp|P9WQD1|ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=acsA PE=1 SV=1 136 530 7.0E-18
sp|P9WQD0|ACSA_MYCTO Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=acsA PE=3 SV=1 136 530 7.0E-18
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 1 530 1.0E-17
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 171 530 2.0E-17
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 1246 1546 3.0E-17
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 169 531 3.0E-17
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 13 530 4.0E-17
sp|Q8VYJ1|MENE_ARATH 2-succinylbenzoate--CoA ligase, chloroplastic/peroxisomal OS=Arabidopsis thaliana GN=AAE14 PE=1 SV=1 177 527 4.0E-17
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1031 1559 6.0E-17
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 32 530 7.0E-17
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 1127 1598 1.0E-16
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 1112 1549 1.0E-16
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 678 1531 4.0E-16
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 1112 1549 4.0E-16
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 176 530 5.0E-16
sp|O94049|ACS1_CANAX Acetyl-coenzyme A synthetase 1 OS=Candida albicans GN=ACS1 PE=3 SV=1 19 530 5.0E-16
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 170 530 8.0E-16
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 172 530 8.0E-16
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 1127 1597 1.0E-15
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1110 1546 2.0E-15
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 1126 1541 3.0E-15
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 70 566 4.0E-15
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1111 1531 4.0E-15
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 779 1572 4.0E-15
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 17 544 4.0E-15
sp|P39062|ACSA_BACSU Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 177 530 4.0E-15
sp|Q58DN7|ACSF3_BOVIN Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 17 530 4.0E-15
sp|Q838K1|MENE_ENTFA 2-succinylbenzoate--CoA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=menE PE=3 SV=1 171 536 4.0E-15
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 170 530 5.0E-15
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 1174 1531 6.0E-15
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 779 1572 7.0E-15
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1037 1580 9.0E-15
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1245 1567 9.0E-15
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 1127 1554 9.0E-15
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 170 540 1.0E-14
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 1127 1554 2.0E-14
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 170 530 2.0E-14
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 502 820 3.0E-14
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 1127 1554 3.0E-14
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 1127 1554 3.0E-14
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 1127 1554 3.0E-14
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 1127 1554 3.0E-14
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 1127 1554 3.0E-14
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 1127 1554 3.0E-14
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 1127 1554 3.0E-14
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 6 530 3.0E-14
sp|Q9CHK3|MENE_LACLA 2-succinylbenzoate--CoA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menE PE=3 SV=2 173 530 4.0E-14
sp|Q7NSY7|ACSA_CHRVO Acetyl-coenzyme A synthetase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=acsA PE=3 SV=1 174 530 4.0E-14
sp|Q63NC4|ACSA_BURPS Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain K96243) GN=acsA PE=3 SV=1 174 530 4.0E-14
sp|A3NH07|ACSA_BURP6 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 668) GN=acsA PE=3 SV=1 174 530 4.0E-14
sp|Q3JH62|ACSA_BURP1 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 1710b) GN=acsA PE=3 SV=1 174 530 4.0E-14
sp|A3P2K7|ACSA_BURP0 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 1106a) GN=acsA PE=3 SV=1 174 530 4.0E-14
sp|A1UWN5|ACSA_BURMS Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain SAVP1) GN=acsA PE=3 SV=1 174 530 4.0E-14
sp|Q62AD1|ACSA_BURMA Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain ATCC 23344) GN=acsA PE=3 SV=1 174 530 4.0E-14
sp|A2RYW5|ACSA_BURM9 Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain NCTC 10229) GN=acsA PE=3 SV=1 174 530 4.0E-14
sp|A3MG40|ACSA_BURM7 Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain NCTC 10247) GN=acsA PE=3 SV=1 174 530 4.0E-14
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 1127 1531 5.0E-14
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 173 526 5.0E-14
sp|Q2T3N9|ACSA_BURTA Acetyl-coenzyme A synthetase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=acsA PE=3 SV=1 174 530 5.0E-14
sp|Q82EL5|ACSA_STRAW Acetyl-coenzyme A synthetase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=acsA PE=3 SV=1 174 570 6.0E-14
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1127 1549 7.0E-14
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 17 530 7.0E-14
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 173 527 7.0E-14
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 1110 1535 9.0E-14
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 1110 1535 1.0E-13
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 1110 1535 1.0E-13
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 1127 1554 1.0E-13
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 1127 1554 1.0E-13
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 1127 1554 1.0E-13
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 1127 1554 1.0E-13
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 1127 1554 1.0E-13
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 1127 1554 1.0E-13
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 170 530 1.0E-13
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 165 530 1.0E-13
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 17 530 1.0E-13
sp|C1D6V9|ACSA_LARHH Acetyl-coenzyme A synthetase OS=Laribacter hongkongensis (strain HLHK9) GN=acsA PE=3 SV=1 174 530 1.0E-13
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 17 530 1.0E-13
sp|Q8XY11|ACSA_RALSO Acetyl-coenzyme A synthetase OS=Ralstonia solanacearum (strain GMI1000) GN=acsA PE=3 SV=1 174 530 2.0E-13
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 164 530 2.0E-13
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 176 530 2.0E-13
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 177 530 3.0E-13
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 17 530 3.0E-13
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 23 543 3.0E-13
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 169 530 3.0E-13
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1128 1545 4.0E-13
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 174 530 4.0E-13
sp|Q82SI5|ACSA_NITEU Acetyl-coenzyme A synthetase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=acsA PE=3 SV=1 174 530 4.0E-13
sp|Q6BQF2|ACS1_DEBHA Acetyl-coenzyme A synthetase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ACS1 PE=3 SV=1 19 530 4.0E-13
sp|Q46Z41|ACSA_CUPPJ Acetyl-coenzyme A synthetase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=acsA PE=3 SV=1 174 530 4.0E-13
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 173 526 5.0E-13
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 17 530 5.0E-13
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 177 530 6.0E-13
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 17 530 6.0E-13
sp|B2U6V1|ACSA_RALPJ Acetyl-coenzyme A synthetase OS=Ralstonia pickettii (strain 12J) GN=acsA PE=3 SV=1 174 530 6.0E-13
sp|A0R5G1|ACSA_MYCS2 Acetyl-coenzyme A synthetase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=acsA PE=3 SV=1 174 530 6.0E-13
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 11 530 6.0E-13
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 11 530 6.0E-13
sp|A4G3L8|ACSA_HERAR Acetyl-coenzyme A synthetase OS=Herminiimonas arsenicoxydans GN=acsA PE=3 SV=1 174 532 8.0E-13
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 17 530 9.0E-13
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1127 1552 1.0E-12
sp|Q9L9F6|NOVL_STRNV 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 166 527 1.0E-12
sp|Q39EK2|ACSA_BURL3 Acetyl-coenzyme A synthetase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=acsA PE=3 SV=1 136 530 1.0E-12
sp|P96575|YDAB_BACSU Putative acyl--CoA ligase YdaB OS=Bacillus subtilis (strain 168) GN=ydaB PE=3 SV=2 10 530 1.0E-12
sp|B2JD61|ACSA_BURP8 Acetyl-coenzyme A synthetase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=acsA PE=3 SV=1 174 530 1.0E-12
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 17 530 2.0E-12
sp|P27095|ACSA_METCN Acetyl-coenzyme A synthetase OS=Methanosaeta concilii GN=acsA PE=1 SV=1 174 530 2.0E-12
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 177 530 2.0E-12
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 169 540 2.0E-12
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 151 530 2.0E-12
sp|P31638|ACSA_CUPNH Acetyl-coenzyme A synthetase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=acsA PE=3 SV=1 174 530 3.0E-12
sp|Q8GB18|CAIC_PROSL Probable crotonobetaine/carnitine-CoA ligase OS=Proteus sp. (strain LE138) GN=caiC PE=3 SV=1 31 530 3.0E-12
sp|A0B8F1|ACSA_METTP Acetyl-coenzyme A synthetase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=acsA PE=1 SV=1 174 530 4.0E-12
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 172 530 4.0E-12
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 172 530 4.0E-12
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 17 530 5.0E-12
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 17 530 5.0E-12
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 17 530 5.0E-12
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 17 530 5.0E-12
sp|B0SRX5|ACSA_LEPBP Acetyl-coenzyme A synthetase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=acsA PE=3 SV=1 164 530 5.0E-12
sp|B0S8X7|ACSA_LEPBA Acetyl-coenzyme A synthetase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=acsA PE=3 SV=1 164 530 5.0E-12
sp|Q1LL27|ACSA_CUPMC Acetyl-coenzyme A synthetase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=acsA PE=3 SV=1 174 530 6.0E-12
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 172 530 6.0E-12
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 177 530 6.0E-12
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 17 530 6.0E-12
sp|B3R1X2|ACSA_CUPTR Acetyl-coenzyme A synthetase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=acsA PE=3 SV=1 174 530 7.0E-12
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 177 530 9.0E-12
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 28 530 1.0E-11
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 13 537 1.0E-11
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 69 530 1.0E-11
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 177 530 1.0E-11
sp|Q9X928|ACSA_STRCO Acetyl-coenzyme A synthetase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=acsA PE=3 SV=1 174 570 1.0E-11
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 172 530 1.0E-11
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 169 530 1.0E-11
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 172 530 1.0E-11
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 173 530 2.0E-11
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 168 530 2.0E-11
sp|O93730|ACSA_PYRAE Acetyl-coenzyme A synthetase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=acsA PE=3 SV=2 173 530 2.0E-11
sp|Q9CMW1|ACSA_PASMU Acetyl-coenzyme A synthetase OS=Pasteurella multocida (strain Pm70) GN=acsA PE=3 SV=1 174 530 2.0E-11
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 177 530 2.0E-11
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 1127 1567 3.0E-11
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 172 530 3.0E-11
sp|Q74RZ6|AAS_YERPE Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 172 526 3.0E-11
sp|Q1CAS8|AAS_YERPA Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 172 526 3.0E-11
sp|B7MNP4|CAIC_ECO81 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 172 530 3.0E-11
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 161 530 3.0E-11
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 172 530 3.0E-11
sp|Q8EYG2|ACSA_LEPIN Acetyl-coenzyme A synthetase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=acsA PE=3 SV=1 174 530 3.0E-11
sp|Q72LY9|ACSA_LEPIC Acetyl-coenzyme A synthetase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=acsA PE=3 SV=1 174 530 3.0E-11
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 169 530 3.0E-11
sp|A4TLD3|AAS_YERPP Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 172 526 3.0E-11
sp|A9R2S1|AAS_YERPG Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 172 526 3.0E-11
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 81 530 4.0E-11
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 81 530 4.0E-11
sp|P31552|CAIC_ECOLI Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 172 530 4.0E-11
sp|B1XBG2|CAIC_ECODH Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 172 530 4.0E-11
sp|C4ZPW3|CAIC_ECOBW Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 172 530 4.0E-11
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 35 530 4.0E-11
sp|P36333|ACSA_PENCH Acetyl-coenzyme A synthetase OS=Penicillium chrysogenum GN=facA PE=3 SV=1 19 530 4.0E-11
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 74 622 5.0E-11
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 103 530 5.0E-11
sp|B1JQC1|AAS_YERPY Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 172 517 5.0E-11
sp|Q667F1|AAS_YERPS Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 172 517 5.0E-11
sp|B2JZ75|AAS_YERPB Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 172 517 5.0E-11
sp|A7FFD1|AAS_YERP3 Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 172 517 5.0E-11
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 161 530 5.0E-11
sp|Q8DKH2|ACSA_THEEB Acetyl-coenzyme A synthetase OS=Thermosynechococcus elongatus (strain BP-1) GN=acsA PE=3 SV=1 153 530 5.0E-11
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 161 530 5.0E-11
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 172 530 6.0E-11
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 69 534 6.0E-11
sp|Q0AFF1|ACSA_NITEC Acetyl-coenzyme A synthetase OS=Nitrosomonas eutropha (strain C91) GN=acsA PE=3 SV=1 174 530 6.0E-11
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 109 540 7.0E-11
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 172 530 7.0E-11
sp|Q27549|ACSA_CRYPV Acetyl-coenzyme A synthetase OS=Cryptosporidium parvum GN=ACS PE=3 SV=1 174 530 7.0E-11
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 172 530 7.0E-11
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 172 530 7.0E-11
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 31 530 8.0E-11
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 161 530 9.0E-11
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 95 524 9.0E-11
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1128 1531 1.0E-10
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 1252 1555 1.0E-10
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 161 530 1.0E-10
sp|Q99NB1|ACS2L_MOUSE Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus GN=Acss1 PE=1 SV=1 174 530 1.0E-10
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 173 526 1.0E-10
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 13 530 1.0E-10
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 172 526 1.0E-10
sp|Q1RGG1|CAIC_ECOUT Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 172 530 1.0E-10
sp|A1A787|CAIC_ECOK1 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 172 530 1.0E-10
sp|Q6FLU2|ACS1_CANGA Acetyl-coenzyme A synthetase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACS1 PE=3 SV=1 19 530 1.0E-10
sp|B5YYD1|CAIC_ECO5E Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 172 530 1.0E-10
sp|Q8XA34|CAIC_ECO57 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 172 530 1.0E-10
sp|B7MAG0|CAIC_ECO45 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiC PE=3 SV=2 172 530 1.0E-10
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 161 530 1.0E-10
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 1107 1528 2.0E-10
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 177 530 2.0E-10
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 153 528 2.0E-10
sp|B5R1R0|CAIC_SALEP Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 161 530 2.0E-10
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 172 530 2.0E-10
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 169 530 2.0E-10
sp|B5F750|CAIC_SALA4 Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 172 530 2.0E-10
sp|Q55404|ACSA_SYNY3 Acetyl-coenzyme A synthetase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=acsA PE=3 SV=1 161 530 2.0E-10
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 177 530 2.0E-10
sp|B7M0D4|CAIC_ECO8A Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 172 530 2.0E-10
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 169 533 2.0E-10
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 172 530 2.0E-10
sp|B6HYY8|CAIC_ECOSE Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 172 530 2.0E-10
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 177 530 2.0E-10
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 161 530 3.0E-10
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 161 530 3.0E-10
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 74 534 3.0E-10
sp|Q9PB89|ACSA_XYLFA Acetyl-coenzyme A synthetase OS=Xylella fastidiosa (strain 9a5c) GN=acsA PE=3 SV=1 174 530 4.0E-10
sp|Q5SIW6|ACSA_THET8 Acetyl-coenzyme A synthetase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=acsA PE=3 SV=1 174 530 4.0E-10
sp|Q72J95|ACSA_THET2 Acetyl-coenzyme A synthetase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=acsA PE=3 SV=1 174 530 4.0E-10
sp|Q1H0J2|ACSA_METFK Acetyl-coenzyme A synthetase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=acsA PE=3 SV=1 174 530 4.0E-10
sp|A7ZHC8|CAIC_ECO24 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 172 530 4.0E-10
sp|P9WQ61|FAA22_MYCTU p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD22 PE=1 SV=1 173 530 4.0E-10
sp|P9WQ60|FAA22_MYCTO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD22 PE=3 SV=1 173 530 4.0E-10
sp|Q7TXK7|FAA22_MYCBO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD22 PE=1 SV=1 173 530 4.0E-10
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 70 530 5.0E-10
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 47 530 5.0E-10
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 169 538 6.0E-10
sp|B2HIL6|FAA22_MYCMM p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD22 PE=1 SV=1 171 530 6.0E-10
sp|Q3Z5X2|CAIC_SHISS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 172 530 7.0E-10
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 172 530 7.0E-10
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 176 534 8.0E-10
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 106 530 8.0E-10
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 176 525 9.0E-10
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 176 525 9.0E-10
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 78 530 9.0E-10
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1248 1549 1.0E-09
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 1252 1543 1.0E-09
sp|C1AA44|ACSA_GEMAT Acetyl-coenzyme A synthetase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=acsA PE=3 SV=1 174 530 1.0E-09
sp|Q8KBY0|ACSA_CHLTE Acetyl-coenzyme A synthetase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=acsA PE=3 SV=2 174 530 1.0E-09
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 47 534 1.0E-09
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 170 530 1.0E-09
sp|Q00594|ALKK_PSEOL Medium-chain-fatty-acid--CoA ligase OS=Pseudomonas oleovorans GN=alkK PE=3 SV=1 141 530 1.0E-09
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 1083 1535 2.0E-09
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 177 530 2.0E-09
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 103 530 2.0E-09
sp|A4YGR1|HPCAS_METS5 3-hydroxypropionyl-coenzyme A synthetase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1456 PE=1 SV=1 174 530 2.0E-09
sp|Q9NUB1|ACS2L_HUMAN Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Homo sapiens GN=ACSS1 PE=1 SV=2 174 530 2.0E-09
sp|Q87C00|ACSA_XYLFT Acetyl-coenzyme A synthetase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=acsA PE=3 SV=1 174 530 2.0E-09
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 71 531 3.0E-09
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 169 530 3.0E-09
sp|A4WJG1|ACSA_PYRAR Acetyl-coenzyme A synthetase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=acsA PE=3 SV=1 173 530 3.0E-09
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 1252 1610 4.0E-09
sp|Q9RRL7|ACSA_DEIRA Acetyl-coenzyme A synthetase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=acsA PE=3 SV=1 174 530 4.0E-09
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 169 484 4.0E-09
sp|Q7M9Y2|ACSA_WOLSU Acetyl-coenzyme A synthetase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=acsA PE=3 SV=1 157 530 5.0E-09
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 13 530 6.0E-09
sp|Q7TXK5|FAA29_MYCBO Long-chain-fatty-acid--AMP ligase FadD29 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD29 PE=3 SV=1 13 488 6.0E-09
sp|P95141|FAA29_MYCTU Long-chain-fatty-acid--AMP ligase FadD29 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD29 PE=1 SV=1 13 488 6.0E-09
sp|Q8ENZ7|MENE_OCEIH 2-succinylbenzoate--CoA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menE PE=3 SV=1 176 531 6.0E-09
sp|Q6BS00|ACS2_DEBHA Acetyl-coenzyme A synthetase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ACS2 PE=3 SV=1 19 530 7.0E-09
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 1252 1573 8.0E-09
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 174 530 8.0E-09
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 174 530 8.0E-09
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 103 530 8.0E-09
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 177 530 9.0E-09
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 1247 1552 1.0E-08
sp|Q758X0|ACS1_ASHGO Acetyl-coenzyme A synthetase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS1 PE=3 SV=1 15 530 1.0E-08
sp|Q91VA0|ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus GN=Acsm1 PE=1 SV=1 176 530 1.0E-08
sp|Q5HNB2|MENE_STAEQ 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menE PE=3 SV=1 171 533 1.0E-08
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 857 1503 2.0E-08
sp|Q3SLF4|ACSA_THIDA Acetyl-coenzyme A synthetase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=acsA PE=3 SV=1 174 530 2.0E-08
sp|Q07VK4|ACSA_RHOP5 Acetyl-coenzyme A synthetase OS=Rhodopseudomonas palustris (strain BisA53) GN=acsA PE=3 SV=1 136 530 2.0E-08
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 177 530 2.0E-08
sp|A8PDE3|ACSA_COPC7 Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ACS-1 PE=3 SV=1 174 530 2.0E-08
sp|P59872|ACSA_RHOBA Acetyl-coenzyme A synthetase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=acsA PE=3 SV=1 163 530 2.0E-08
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 169 530 2.0E-08
sp|Q056J9|ACSA_LEPBL Acetyl-coenzyme A synthetase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=acsA PE=3 SV=1 174 530 3.0E-08
sp|Q04P35|ACSA_LEPBJ Acetyl-coenzyme A synthetase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=acsA PE=3 SV=1 174 530 3.0E-08
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 177 530 3.0E-08
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 1252 1555 4.0E-08
sp|A1WY97|ACSA_HALHL Acetyl-coenzyme A synthetase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=acsA PE=3 SV=1 158 530 4.0E-08
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 13 530 4.0E-08
sp|Q8K0L3|ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus GN=Acsm2 PE=1 SV=1 64 534 6.0E-08
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 1243 1418 7.0E-08
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 106 530 7.0E-08
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 177 530 7.0E-08
sp|Q9Y7B5|ACS2_KLULA Acetyl-coenzyme A synthetase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACS2 PE=3 SV=2 93 530 7.0E-08
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 1126 1497 1.0E-07
sp|Q554Z5|ACSB_DICDI Acyl-CoA synthetase short-chain family member B, mitochondrial OS=Dictyostelium discoideum GN=aslB PE=3 SV=1 174 470 1.0E-07
sp|A4YK73|ACSA_BRASO Acetyl-coenzyme A synthetase OS=Bradyrhizobium sp. (strain ORS278) GN=acsA PE=3 SV=1 174 530 2.0E-07
sp|Q01576|ACSA_PHYB8 Acetyl-coenzyme A synthetase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=facA PE=2 SV=1 19 530 2.0E-07
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 34 530 2.0E-07
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 160 548 2.0E-07
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 160 548 2.0E-07
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 177 530 2.0E-07
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 1247 1407 3.0E-07
sp|O13440|ACSA_COPCI Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea GN=ACS-1 PE=2 SV=1 174 530 3.0E-07
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 1121 1497 4.0E-07
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 34 530 4.0E-07
sp|Q5LRT0|DMDB_RUEPO 3-methylmercaptopropionyl-CoA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdB PE=1 SV=1 138 530 4.0E-07
sp|B8FIN2|ACSA_DESAA Acetyl-coenzyme A synthetase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=acsA PE=3 SV=1 174 530 4.0E-07
sp|Q8P3L1|ACSA_XANCP Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=acsA PE=3 SV=1 174 530 5.0E-07
sp|Q4UP35|ACSA_XANC8 Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=acsA PE=3 SV=1 174 530 5.0E-07
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 1074 1566 6.0E-07
sp|Q8GVF9|4CLL8_ORYSJ Putative 4-coumarate--CoA ligase-like 8 OS=Oryza sativa subsp. japonica GN=4CLL8 PE=3 SV=1 344 530 6.0E-07
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 163 530 6.0E-07
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 1252 1598 7.0E-07
sp|Q6MNF1|ACSA_BDEBA Acetyl-coenzyme A synthetase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=acsA PE=3 SV=1 174 530 7.0E-07
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 360 955 8.0E-07
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 177 530 8.0E-07
sp|Q8PF09|ACSA_XANAC Acetyl-coenzyme A synthetase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=acsA PE=3 SV=1 174 530 8.0E-07
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 508 643 9.0E-07
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 504 643 1.0E-06
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 494 919 1.0E-06
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 1116 1552 1.0E-06
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 1116 1552 1.0E-06
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 1121 1497 1.0E-06
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 1115 1553 1.0E-06
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 1121 1497 1.0E-06
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 1121 1497 1.0E-06
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 1121 1497 1.0E-06
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 169 530 1.0E-06
sp|Q73ZP7|MBTM_MYCPA Long-chain-fatty-acid--[acyl-carrier-protein] ligase MbtM OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtM PE=3 SV=1 114 527 1.0E-06
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 159 537 1.0E-06
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 1121 1497 2.0E-06
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 1243 1546 2.0E-06
sp|P63526|MENE_STAAN 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain N315) GN=menE PE=1 SV=1 17 530 2.0E-06
sp|P63525|MENE_STAAM 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menE PE=3 SV=1 17 530 2.0E-06
sp|A5ITW2|MENE_STAA9 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH9) GN=menE PE=3 SV=1 17 530 2.0E-06
sp|A6U2Q7|MENE_STAA2 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH1) GN=menE PE=3 SV=1 17 530 2.0E-06
sp|A7X3P0|MENE_STAA1 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menE PE=3 SV=1 17 530 2.0E-06
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 177 530 2.0E-06
sp|Q2YTP0|MENE_STAAB 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menE PE=3 SV=1 17 530 2.0E-06
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 1121 1497 3.0E-06
sp|Q2LW77|ACSA_SYNAS Acetyl-coenzyme A synthetase OS=Syntrophus aciditrophicus (strain SB) GN=acsA PE=3 SV=1 174 530 3.0E-06
sp|O24540|4CL_VANPL 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 156 528 3.0E-06
sp|O53551|FAC17_MYCTU Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD17 PE=1 SV=1 176 480 3.0E-06
sp|Q7TWC5|FAC17_MYCBO Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD17 PE=3 SV=1 176 480 3.0E-06
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 1121 1497 4.0E-06
sp|Q4FVA1|ACSA_PSYA2 Acetyl-coenzyme A synthetase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=acsA PE=3 SV=1 174 530 4.0E-06
sp|A0KNI2|ACSA_AERHH Acetyl-coenzyme A synthetase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=acsA PE=3 SV=1 92 530 4.0E-06
sp|Q2NXE2|ACSA_XANOM Acetyl-coenzyme A synthetase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=acsA PE=3 SV=1 174 530 5.0E-06
sp|Q8NVZ4|MENE_STAAW 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MW2) GN=menE PE=3 SV=1 17 530 5.0E-06
sp|Q6G8D6|MENE_STAAS 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MSSA476) GN=menE PE=3 SV=1 17 530 5.0E-06
sp|B2HHZ8|FAC17_MYCMM Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD17 PE=3 SV=1 68 533 5.0E-06
sp|Q1QEB6|ACSA_PSYCK Acetyl-coenzyme A synthetase OS=Psychrobacter cryohalolentis (strain K5) GN=acsA PE=3 SV=1 174 530 6.0E-06
sp|Q87KU7|ACSA_VIBPA Acetyl-coenzyme A synthetase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=acsA PE=3 SV=1 92 530 6.0E-06
sp|Q6GFR0|MENE_STAAR 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MRSA252) GN=menE PE=3 SV=1 17 530 6.0E-06
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 1121 1497 9.0E-06
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 1121 1497 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Yes
GO:0009877 nodulation Yes
GO:0003824 catalytic activity Yes
GO:0009312 oligosaccharide biosynthetic process Yes
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0044238 primary metabolic process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0044419 interspecies interaction between organisms No
GO:0005975 carbohydrate metabolic process No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0044403 symbiont process No
GO:1901576 organic substance biosynthetic process No
GO:0009311 oligosaccharide metabolic process No
GO:0051704 multi-organism process No
GO:0009058 biosynthetic process No
GO:0008150 biological_process No
GO:0016051 carbohydrate biosynthetic process No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7663
MGLATYQEPVRRLEQLLYRRAAEHPDAPAIEDEGGVVDYRTALCRARTIASGLIRAASENDVPLHQNPTVGICIQ
RGSSAIVALLGALAAGCCYVPLALDAGSERLARTLAISGIRIVLTDDASSQALSGKLDDGRTGARPVLVSVEALL
AQHADSGATGAAMPSTPFQSSTAYTLFSSGTTGKPKGISMSHSSVLHYLNASRRTFKTTRLDRWLHAAPYTFDVS
LEELFVPLSAGACIVCQPRGGLDSLAGYLEFMAASHITAVSMPTAFWHRLSPHLVDSGDSLPSSLRLVVIGGEAA
RTDAYRQWASAVRGRVELVNAYGPTESCVSATFGTRFDLADTTLSIGRPLPGMEAYVAERDADVLVPDGQVGRLL
LAGPQLAVGYRGDPALSATKFFANPFEDWVMPGYERVYDTGDLVVRKPTGELAFCGRVDLQLQVRGQRVEAEGVE
TVLAACASVTEASIIVVEDQGSEAMVAFLVPREGLPEEVVVPDVEKSCAVHLVAFEKPSHFVLLDELPLNASGKV
DKKALAVEWHERRSKPAHASISPVVTETEKSLADLWRQALSLEPSVRLGRESSLARLGGHSLTMVTLTSKIYSRF
NVRVTVPELLRHQQLSEMADFLESRPASSMVEPSATLGADTDGVFDLTPSQEQLYLAQSKEPDSPFFNDGVAIQI
QGPCDPQLLEDAAKRIVRRHAALRCVLVGTGSSGKVQQRVLPLSGSLWESIWNHQLVSPNQLERVSADLFSVPLD
LFSGPLLKIHLLEGRQEEGAGPDARVSILIVQAHHICWDGFSDGIFLEELKTLYRDPAAALGNHAPVMTTLSPQP
GAADASIAELGDYLRNVPESVDLPTDLAPPQKKSYSRGGVVRFELAAALMRQALASAGRDITPTSLLLTVYAAVL
RRFAGGQSDLALGVPMANRVTAEAAARIGFFVNMLPLRVQAEDEHRLSDLLGMVEAGLDTLRRNQDVLLADVYRR
QQSSSSTHERLLRFCFSFQDAPEGKLVDGCTFRRWPLHNGAARADLTCFTELCIDGTISGELEYDADLFDRETIA
SISDCMVYVLQSIASHQAWEKSLGQLALVEAQPKDVFAMGGNLGNQAEDLGSYLLRAVDACEKPDIAIVDEVSGC
RITYGELSKRARCMACQIHVTASRPGPVLLLLRRSWEVPVSQMASALAGRPWICCDVSQPRERLMRIIDEANPGC
IVSQSGIVADIPSLSNHGVPILYPLELFNSAWDAACEIPQTPREGNLAYVIYTSGTTGTPKGVAIEQRSFIQFVD
HIRSWTARPGGPTAFNSILTSNTAFDGSLSQMYSALTTGGRLIITKHGGEQDGEYVAATLSKHDINYLCTTTAAV
RLWMSQASQSHPEFFGPHFRCLLLGGDELPPVFLSTIFARSSCPEKVEVKNVYGPTEGTIFSSYGDYRASDLSWL
RGRRRSPIDTTLPSAAISVVGPDLRDLPRGAVGEIVIWGSCLAREYLDLPELNAVKFVSRGQLRGWRTGDLGRWT
GSGGGGAFEVLGRADSMRKVLGGFRVDLDEVGLAVASHAEVRECHVSTVEEEDEEGARQTKVVAHVVLHQQQREQ
QDLETVSNWRTMFTDVNHSLEEYDDEGIDLAFDYRGWASSFDRSTIPKSEMEEWVSCTVDRILDLDCFQGGKRPR
VAEIGCGTGMIVFRLADKVSSYYGTDLAESTVAQVQRHAGSLGHKHIQTRALPAHEFDNLLPESERFDLIICNSV
AQYFPSLDYLEQVLRRARSRLNPGGLLFMGDIRHEGLKTHHAVTSAFSRGARTAAALRLSAVDILEKDRELQVDP
SFFVDRCGAIDRLFQGRARIEWRRGSAPTEMTLFRYDAVLMAVAQEAEAGERRSERLPTMTLPSPPCQSLGQAGI
QRRPFLKYKQPVTTL*
Coding >Hirsu2|7663
ATGGGTCTCGCGACGTACCAGGAGCCTGTCAGGCGGCTGGAGCAACTCCTGTACAGGCGTGCGGCCGAGCATCCT
GATGCGCCTGCCATAGAGGACGAGGGGGGCGTTGTCGATTACAGAACAGCACTATGCCGTGCCCGGACGATTGCC
TCTGGGCTCATCAGAGCCGCGTCTGAAAACGACGTGCCCTTACACCAAAACCCGACTGTGGGCATCTGCATCCAA
AGGGGGTCGAGTGCCATTGTGGCTCTCCTGGGCGCCTTGGCAGCCGGCTGCTGCTATGTCCCTCTCGCCCTGGAT
GCCGGGAGCGAGAGGCTGGCGCGGACTTTGGCGATATCCGGCATCCGGATCGTCCTCACCGACGACGCCTCTTCT
CAGGCTCTGAGCGGCAAGCTAGATGATGGACGAACCGGGGCGAGGCCGGTGCTGGTCAGCGTGGAAGCACTGCTG
GCGCAGCACGCGGACAGCGGCGCGACAGGCGCCGCGATGCCCTCGACGCCGTTCCAGAGCAGCACGGCCTACACG
CTGTTCTCGTCCGGCACGACGGGCAAGCCAAAGGGCATCAGCATGTCGCACTCCTCGGTCCTGCACTACCTGAAC
GCGAGCAGGCGCACCTTCAAGACCACGCGCCTCGACCGCTGGCTCCACGCGGCCCCGTACACCTTCGACGTCAGC
CTCGAGGAGCTCTTCGTCCCGCTCAGCGCCGGCGCCTGCATCGTCTGCCAGCCCCGGGGGGGTCTCGACTCGCTC
GCCGGCTACCTCGAGTTCATGGCCGCTTCGCACATCACGGCCGTGTCGATGCCCACGGCCTTCTGGCACCGCCTG
TCGCCGCACCTCGTCGACAGCGGCGACAGCCTCCCCAGCAGCCTCCGCCTCGTCGTCATCGGGGGAGAGGCGGCA
CGGACCGACGCATACCGGCAGTGGGCCTCGGCGGTTAGGGGCCGCGTCGAGCTTGTCAACGCCTACGGGCCGACG
GAGAGCTGCGTCTCGGCCACGTTCGGCACGCGCTTCGATCTCGCCGACACGACGTTGAGCATAGGGCGGCCCTTG
CCGGGGATGGAGGCGTACGTCGCTGAGCGCGATGCCGACGTGCTCGTGCCTGACGGCCAAGTCGGGCGTCTGCTG
CTGGCCGGGCCGCAGTTGGCTGTCGGGTACCGGGGCGACCCGGCGCTCTCGGCGACCAAGTTCTTCGCCAACCCG
TTCGAGGATTGGGTGATGCCCGGATACGAGCGCGTCTATGACACGGGGGACCTGGTTGTCCGGAAGCCGACAGGC
GAGCTTGCCTTCTGCGGCCGGGTCGACTTGCAGCTTCAGGTCCGCGGCCAGAGAGTCGAGGCCGAGGGTGTCGAG
ACCGTTCTCGCCGCCTGCGCGTCCGTCACGGAAGCTTCCATCATCGTGGTGGAGGACCAGGGATCCGAGGCCATG
GTCGCCTTTCTCGTCCCGCGCGAGGGACTGCCTGAAGAGGTTGTCGTGCCCGACGTCGAAAAGAGCTGCGCCGTC
CACCTCGTGGCTTTCGAAAAGCCTTCGCACTTTGTACTGCTGGACGAGCTGCCGCTCAACGCGAGCGGCAAGGTA
GACAAGAAAGCCTTGGCAGTCGAGTGGCATGAGCGAAGATCCAAGCCCGCCCACGCATCGATTTCACCGGTCGTC
ACCGAGACGGAAAAGTCGCTGGCCGACTTATGGCGGCAGGCACTTTCTCTGGAGCCATCGGTCCGGCTCGGCAGG
GAGAGCAGCCTCGCCAGGTTAGGCGGCCACTCCTTGACCATGGTCACCTTGACGAGCAAGATATACAGCCGATTC
AACGTCAGGGTCACCGTCCCCGAGCTTCTGCGACACCAGCAGCTGTCAGAAATGGCCGACTTCCTGGAAAGCAGG
CCGGCCAGCTCCATGGTGGAGCCATCAGCCACATTGGGAGCTGATACCGACGGCGTCTTTGACCTGACGCCGAGC
CAGGAGCAGCTGTATTTGGCTCAGAGCAAAGAGCCCGACTCTCCCTTTTTCAACGACGGCGTGGCGATCCAGATT
CAGGGGCCCTGTGACCCACAACTTCTCGAGGACGCCGCCAAGCGCATCGTGCGGCGGCATGCGGCCCTCCGATGC
GTCCTCGTTGGTACCGGAAGTTCCGGTAAGGTGCAGCAACGCGTCCTTCCGCTCAGCGGTTCTTTGTGGGAGAGC
ATCTGGAATCATCAGCTAGTTAGCCCGAACCAGCTCGAAAGGGTCAGCGCCGACTTGTTCAGTGTACCCCTCGAC
CTCTTCTCGGGGCCCTTGCTCAAGATTCACCTGCTGGAAGGCAGGCAGGAGGAGGGGGCAGGGCCGGATGCAAGG
GTATCGATCCTGATCGTACAGGCACATCACATCTGCTGGGATGGCTTCTCCGACGGTATCTTTCTTGAAGAACTC
AAGACCTTGTACCGAGACCCGGCTGCTGCGTTGGGAAACCATGCCCCCGTCATGACCACGCTCAGCCCACAGCCC
GGAGCGGCCGATGCCTCCATCGCGGAACTGGGCGATTACCTTCGCAATGTGCCCGAATCCGTCGACCTTCCGACA
GACTTGGCGCCTCCGCAGAAGAAGAGCTACAGCCGGGGCGGTGTTGTGCGGTTCGAGCTGGCTGCGGCCTTGATG
CGTCAAGCTCTTGCGTCGGCTGGACGGGATATAACGCCAACGTCGCTTTTGCTCACCGTGTACGCAGCCGTGCTT
CGGCGCTTCGCCGGCGGTCAGAGCGACCTTGCTCTAGGAGTCCCCATGGCCAACAGAGTGACGGCCGAGGCTGCG
GCGCGTATAGGCTTCTTCGTTAACATGCTTCCCCTCAGAGTCCAGGCCGAGGATGAGCACCGGCTATCCGACCTC
CTCGGCATGGTCGAAGCCGGGCTGGATACGCTGCGCAGAAACCAGGACGTGCTCCTGGCCGATGTGTACCGTCGG
CAGCAGAGCTCGAGCTCTACGCATGAACGATTGCTCAGGTTCTGCTTCTCTTTCCAGGATGCCCCCGAGGGAAAG
CTGGTCGATGGTTGCACCTTCAGGCGGTGGCCGCTTCACAACGGCGCCGCACGCGCCGACTTGACTTGCTTTACC
GAGCTCTGTATCGACGGAACCATCTCGGGCGAGCTCGAATACGATGCGGACCTCTTTGACCGCGAAACGATAGCT
TCCATCTCGGACTGCATGGTGTACGTGTTGCAGAGCATCGCCTCACATCAGGCATGGGAGAAGTCTCTGGGACAA
CTCGCTCTGGTCGAGGCCCAGCCAAAGGATGTGTTCGCCATGGGCGGCAACTTGGGCAATCAAGCAGAAGATCTC
GGCTCATACCTTCTTCGGGCTGTTGATGCTTGCGAGAAGCCCGACATTGCGATTGTCGACGAGGTTTCGGGCTGC
CGCATCACATACGGAGAGCTGTCAAAGAGGGCAAGATGTATGGCGTGCCAGATCCATGTGACAGCGTCCCGGCCA
GGGCCAGTGCTACTGCTCCTCCGGAGATCCTGGGAAGTTCCCGTCTCCCAGATGGCCTCTGCTCTGGCTGGTCGG
CCCTGGATCTGCTGCGATGTTAGCCAGCCGCGCGAAAGACTGATGCGCATCATCGATGAGGCGAATCCGGGCTGC
ATCGTCTCACAAAGCGGTATCGTTGCCGACATCCCATCCCTTTCGAACCACGGCGTTCCCATTCTCTACCCCTTG
GAGCTTTTCAACAGCGCATGGGATGCCGCTTGCGAGATTCCCCAGACGCCTCGAGAAGGCAACCTGGCCTACGTC
ATCTACACGAGTGGAACGACCGGAACGCCTAAAGGAGTGGCCATCGAGCAGCGGAGCTTCATTCAGTTCGTCGAC
CACATCCGGTCGTGGACGGCGCGACCCGGGGGTCCGACAGCATTCAACAGCATTCTCACGTCAAACACGGCGTTC
GACGGATCCCTGTCCCAGATGTACTCGGCGCTCACGACCGGCGGAAGGCTCATCATCACCAAACATGGGGGCGAG
CAGGACGGAGAGTACGTGGCCGCGACGCTGAGCAAGCACGACATCAACTACCTCTGCACCACCACGGCCGCTGTC
CGCCTGTGGATGAGCCAGGCCTCACAGTCGCACCCCGAGTTCTTCGGGCCGCACTTCCGATGCCTTCTCCTCGGT
GGGGATGAGCTTCCTCCCGTATTCTTGTCGACCATATTCGCGCGATCGAGTTGCCCCGAAAAGGTCGAGGTGAAG
AACGTGTACGGCCCTACCGAAGGCACCATCTTCTCGTCATATGGCGATTACAGGGCGTCCGACTTGAGCTGGCTC
AGGGGCAGACGCCGGAGCCCGATCGATACGACGTTGCCGAGCGCGGCCATCTCCGTCGTGGGCCCAGACCTGCGA
GACCTTCCCAGGGGCGCCGTGGGCGAGATCGTCATATGGGGTTCGTGTCTGGCCAGAGAGTATCTCGACCTGCCC
GAGCTAAATGCGGTCAAGTTCGTCAGCCGCGGCCAGTTGCGGGGGTGGAGGACTGGAGATCTCGGGAGGTGGACC
GGCTCAGGCGGCGGTGGTGCTTTTGAGGTGCTGGGCAGGGCCGATTCGATGCGCAAGGTCCTGGGCGGCTTTCGG
GTCGACCTGGACGAGGTCGGGCTGGCCGTGGCCAGCCACGCAGAGGTCCGCGAATGCCACGTCTCGACCGTGGAG
GAAGAAGACGAAGAAGGCGCCAGACAGACCAAGGTGGTGGCTCACGTCGTCTTGCACCAGCAGCAGCGAGAGCAG
CAAGACCTCGAGACGGTTTCCAACTGGCGAACCATGTTCACCGATGTCAACCACAGTCTCGAGGAGTACGACGAC
GAGGGCATCGACCTGGCCTTTGACTACCGCGGCTGGGCCTCAAGCTTCGACCGGAGCACCATCCCCAAGTCCGAG
ATGGAGGAATGGGTCAGCTGCACCGTGGACCGCATTCTCGATCTGGATTGCTTCCAGGGAGGGAAGAGGCCGCGG
GTTGCCGAGATAGGCTGCGGCACCGGCATGATCGTCTTCCGCCTCGCCGACAAGGTCAGCAGCTACTACGGCACA
GACTTGGCCGAGTCCACGGTGGCCCAGGTGCAGCGACATGCAGGAAGCCTGGGCCACAAGCACATCCAGACACGG
GCGCTGCCGGCGCACGAGTTCGATAACCTGCTGCCCGAGAGTGAGCGCTTCGACCTCATCATCTGCAACTCGGTG
GCCCAGTATTTCCCGTCTCTCGACTACCTCGAGCAGGTGCTCAGGCGAGCCCGCAGCAGGCTGAACCCCGGCGGG
CTGCTCTTCATGGGCGATATCCGCCATGAGGGACTCAAGACGCACCACGCCGTCACGTCGGCGTTTTCCAGGGGA
GCTCGAACAGCCGCGGCGCTGCGGCTGTCCGCAGTCGACATCCTGGAGAAGGATCGAGAGCTTCAGGTCGACCCG
TCCTTCTTTGTGGACCGGTGCGGCGCAATTGACCGGCTCTTCCAAGGGCGTGCGAGGATCGAGTGGAGGAGAGGG
TCGGCTCCGACGGAGATGACGCTGTTCCGATACGATGCGGTGCTTATGGCGGTGGCCCAGGAAGCGGAAGCGGGC
GAGCGGCGATCGGAACGGTTGCCGACCATGACGCTGCCGTCTCCGCCGTGCCAGAGTCTCGGACAGGCTGGGATC
CAGAGGCGGCCGTTTCTGAAGTACAAGCAGCCGGTCACGACGCTCTGA
Transcript >Hirsu2|7663
ATGGGTCTCGCGACGTACCAGGAGCCTGTCAGGCGGCTGGAGCAACTCCTGTACAGGCGTGCGGCCGAGCATCCT
GATGCGCCTGCCATAGAGGACGAGGGGGGCGTTGTCGATTACAGAACAGCACTATGCCGTGCCCGGACGATTGCC
TCTGGGCTCATCAGAGCCGCGTCTGAAAACGACGTGCCCTTACACCAAAACCCGACTGTGGGCATCTGCATCCAA
AGGGGGTCGAGTGCCATTGTGGCTCTCCTGGGCGCCTTGGCAGCCGGCTGCTGCTATGTCCCTCTCGCCCTGGAT
GCCGGGAGCGAGAGGCTGGCGCGGACTTTGGCGATATCCGGCATCCGGATCGTCCTCACCGACGACGCCTCTTCT
CAGGCTCTGAGCGGCAAGCTAGATGATGGACGAACCGGGGCGAGGCCGGTGCTGGTCAGCGTGGAAGCACTGCTG
GCGCAGCACGCGGACAGCGGCGCGACAGGCGCCGCGATGCCCTCGACGCCGTTCCAGAGCAGCACGGCCTACACG
CTGTTCTCGTCCGGCACGACGGGCAAGCCAAAGGGCATCAGCATGTCGCACTCCTCGGTCCTGCACTACCTGAAC
GCGAGCAGGCGCACCTTCAAGACCACGCGCCTCGACCGCTGGCTCCACGCGGCCCCGTACACCTTCGACGTCAGC
CTCGAGGAGCTCTTCGTCCCGCTCAGCGCCGGCGCCTGCATCGTCTGCCAGCCCCGGGGGGGTCTCGACTCGCTC
GCCGGCTACCTCGAGTTCATGGCCGCTTCGCACATCACGGCCGTGTCGATGCCCACGGCCTTCTGGCACCGCCTG
TCGCCGCACCTCGTCGACAGCGGCGACAGCCTCCCCAGCAGCCTCCGCCTCGTCGTCATCGGGGGAGAGGCGGCA
CGGACCGACGCATACCGGCAGTGGGCCTCGGCGGTTAGGGGCCGCGTCGAGCTTGTCAACGCCTACGGGCCGACG
GAGAGCTGCGTCTCGGCCACGTTCGGCACGCGCTTCGATCTCGCCGACACGACGTTGAGCATAGGGCGGCCCTTG
CCGGGGATGGAGGCGTACGTCGCTGAGCGCGATGCCGACGTGCTCGTGCCTGACGGCCAAGTCGGGCGTCTGCTG
CTGGCCGGGCCGCAGTTGGCTGTCGGGTACCGGGGCGACCCGGCGCTCTCGGCGACCAAGTTCTTCGCCAACCCG
TTCGAGGATTGGGTGATGCCCGGATACGAGCGCGTCTATGACACGGGGGACCTGGTTGTCCGGAAGCCGACAGGC
GAGCTTGCCTTCTGCGGCCGGGTCGACTTGCAGCTTCAGGTCCGCGGCCAGAGAGTCGAGGCCGAGGGTGTCGAG
ACCGTTCTCGCCGCCTGCGCGTCCGTCACGGAAGCTTCCATCATCGTGGTGGAGGACCAGGGATCCGAGGCCATG
GTCGCCTTTCTCGTCCCGCGCGAGGGACTGCCTGAAGAGGTTGTCGTGCCCGACGTCGAAAAGAGCTGCGCCGTC
CACCTCGTGGCTTTCGAAAAGCCTTCGCACTTTGTACTGCTGGACGAGCTGCCGCTCAACGCGAGCGGCAAGGTA
GACAAGAAAGCCTTGGCAGTCGAGTGGCATGAGCGAAGATCCAAGCCCGCCCACGCATCGATTTCACCGGTCGTC
ACCGAGACGGAAAAGTCGCTGGCCGACTTATGGCGGCAGGCACTTTCTCTGGAGCCATCGGTCCGGCTCGGCAGG
GAGAGCAGCCTCGCCAGGTTAGGCGGCCACTCCTTGACCATGGTCACCTTGACGAGCAAGATATACAGCCGATTC
AACGTCAGGGTCACCGTCCCCGAGCTTCTGCGACACCAGCAGCTGTCAGAAATGGCCGACTTCCTGGAAAGCAGG
CCGGCCAGCTCCATGGTGGAGCCATCAGCCACATTGGGAGCTGATACCGACGGCGTCTTTGACCTGACGCCGAGC
CAGGAGCAGCTGTATTTGGCTCAGAGCAAAGAGCCCGACTCTCCCTTTTTCAACGACGGCGTGGCGATCCAGATT
CAGGGGCCCTGTGACCCACAACTTCTCGAGGACGCCGCCAAGCGCATCGTGCGGCGGCATGCGGCCCTCCGATGC
GTCCTCGTTGGTACCGGAAGTTCCGGTAAGGTGCAGCAACGCGTCCTTCCGCTCAGCGGTTCTTTGTGGGAGAGC
ATCTGGAATCATCAGCTAGTTAGCCCGAACCAGCTCGAAAGGGTCAGCGCCGACTTGTTCAGTGTACCCCTCGAC
CTCTTCTCGGGGCCCTTGCTCAAGATTCACCTGCTGGAAGGCAGGCAGGAGGAGGGGGCAGGGCCGGATGCAAGG
GTATCGATCCTGATCGTACAGGCACATCACATCTGCTGGGATGGCTTCTCCGACGGTATCTTTCTTGAAGAACTC
AAGACCTTGTACCGAGACCCGGCTGCTGCGTTGGGAAACCATGCCCCCGTCATGACCACGCTCAGCCCACAGCCC
GGAGCGGCCGATGCCTCCATCGCGGAACTGGGCGATTACCTTCGCAATGTGCCCGAATCCGTCGACCTTCCGACA
GACTTGGCGCCTCCGCAGAAGAAGAGCTACAGCCGGGGCGGTGTTGTGCGGTTCGAGCTGGCTGCGGCCTTGATG
CGTCAAGCTCTTGCGTCGGCTGGACGGGATATAACGCCAACGTCGCTTTTGCTCACCGTGTACGCAGCCGTGCTT
CGGCGCTTCGCCGGCGGTCAGAGCGACCTTGCTCTAGGAGTCCCCATGGCCAACAGAGTGACGGCCGAGGCTGCG
GCGCGTATAGGCTTCTTCGTTAACATGCTTCCCCTCAGAGTCCAGGCCGAGGATGAGCACCGGCTATCCGACCTC
CTCGGCATGGTCGAAGCCGGGCTGGATACGCTGCGCAGAAACCAGGACGTGCTCCTGGCCGATGTGTACCGTCGG
CAGCAGAGCTCGAGCTCTACGCATGAACGATTGCTCAGGTTCTGCTTCTCTTTCCAGGATGCCCCCGAGGGAAAG
CTGGTCGATGGTTGCACCTTCAGGCGGTGGCCGCTTCACAACGGCGCCGCACGCGCCGACTTGACTTGCTTTACC
GAGCTCTGTATCGACGGAACCATCTCGGGCGAGCTCGAATACGATGCGGACCTCTTTGACCGCGAAACGATAGCT
TCCATCTCGGACTGCATGGTGTACGTGTTGCAGAGCATCGCCTCACATCAGGCATGGGAGAAGTCTCTGGGACAA
CTCGCTCTGGTCGAGGCCCAGCCAAAGGATGTGTTCGCCATGGGCGGCAACTTGGGCAATCAAGCAGAAGATCTC
GGCTCATACCTTCTTCGGGCTGTTGATGCTTGCGAGAAGCCCGACATTGCGATTGTCGACGAGGTTTCGGGCTGC
CGCATCACATACGGAGAGCTGTCAAAGAGGGCAAGATGTATGGCGTGCCAGATCCATGTGACAGCGTCCCGGCCA
GGGCCAGTGCTACTGCTCCTCCGGAGATCCTGGGAAGTTCCCGTCTCCCAGATGGCCTCTGCTCTGGCTGGTCGG
CCCTGGATCTGCTGCGATGTTAGCCAGCCGCGCGAAAGACTGATGCGCATCATCGATGAGGCGAATCCGGGCTGC
ATCGTCTCACAAAGCGGTATCGTTGCCGACATCCCATCCCTTTCGAACCACGGCGTTCCCATTCTCTACCCCTTG
GAGCTTTTCAACAGCGCATGGGATGCCGCTTGCGAGATTCCCCAGACGCCTCGAGAAGGCAACCTGGCCTACGTC
ATCTACACGAGTGGAACGACCGGAACGCCTAAAGGAGTGGCCATCGAGCAGCGGAGCTTCATTCAGTTCGTCGAC
CACATCCGGTCGTGGACGGCGCGACCCGGGGGTCCGACAGCATTCAACAGCATTCTCACGTCAAACACGGCGTTC
GACGGATCCCTGTCCCAGATGTACTCGGCGCTCACGACCGGCGGAAGGCTCATCATCACCAAACATGGGGGCGAG
CAGGACGGAGAGTACGTGGCCGCGACGCTGAGCAAGCACGACATCAACTACCTCTGCACCACCACGGCCGCTGTC
CGCCTGTGGATGAGCCAGGCCTCACAGTCGCACCCCGAGTTCTTCGGGCCGCACTTCCGATGCCTTCTCCTCGGT
GGGGATGAGCTTCCTCCCGTATTCTTGTCGACCATATTCGCGCGATCGAGTTGCCCCGAAAAGGTCGAGGTGAAG
AACGTGTACGGCCCTACCGAAGGCACCATCTTCTCGTCATATGGCGATTACAGGGCGTCCGACTTGAGCTGGCTC
AGGGGCAGACGCCGGAGCCCGATCGATACGACGTTGCCGAGCGCGGCCATCTCCGTCGTGGGCCCAGACCTGCGA
GACCTTCCCAGGGGCGCCGTGGGCGAGATCGTCATATGGGGTTCGTGTCTGGCCAGAGAGTATCTCGACCTGCCC
GAGCTAAATGCGGTCAAGTTCGTCAGCCGCGGCCAGTTGCGGGGGTGGAGGACTGGAGATCTCGGGAGGTGGACC
GGCTCAGGCGGCGGTGGTGCTTTTGAGGTGCTGGGCAGGGCCGATTCGATGCGCAAGGTCCTGGGCGGCTTTCGG
GTCGACCTGGACGAGGTCGGGCTGGCCGTGGCCAGCCACGCAGAGGTCCGCGAATGCCACGTCTCGACCGTGGAG
GAAGAAGACGAAGAAGGCGCCAGACAGACCAAGGTGGTGGCTCACGTCGTCTTGCACCAGCAGCAGCGAGAGCAG
CAAGACCTCGAGACGGTTTCCAACTGGCGAACCATGTTCACCGATGTCAACCACAGTCTCGAGGAGTACGACGAC
GAGGGCATCGACCTGGCCTTTGACTACCGCGGCTGGGCCTCAAGCTTCGACCGGAGCACCATCCCCAAGTCCGAG
ATGGAGGAATGGGTCAGCTGCACCGTGGACCGCATTCTCGATCTGGATTGCTTCCAGGGAGGGAAGAGGCCGCGG
GTTGCCGAGATAGGCTGCGGCACCGGCATGATCGTCTTCCGCCTCGCCGACAAGGTCAGCAGCTACTACGGCACA
GACTTGGCCGAGTCCACGGTGGCCCAGGTGCAGCGACATGCAGGAAGCCTGGGCCACAAGCACATCCAGACACGG
GCGCTGCCGGCGCACGAGTTCGATAACCTGCTGCCCGAGAGTGAGCGCTTCGACCTCATCATCTGCAACTCGGTG
GCCCAGTATTTCCCGTCTCTCGACTACCTCGAGCAGGTGCTCAGGCGAGCCCGCAGCAGGCTGAACCCCGGCGGG
CTGCTCTTCATGGGCGATATCCGCCATGAGGGACTCAAGACGCACCACGCCGTCACGTCGGCGTTTTCCAGGGGA
GCTCGAACAGCCGCGGCGCTGCGGCTGTCCGCAGTCGACATCCTGGAGAAGGATCGAGAGCTTCAGGTCGACCCG
TCCTTCTTTGTGGACCGGTGCGGCGCAATTGACCGGCTCTTCCAAGGGCGTGCGAGGATCGAGTGGAGGAGAGGG
TCGGCTCCGACGGAGATGACGCTGTTCCGATACGATGCGGTGCTTATGGCGGTGGCCCAGGAAGCGGAAGCGGGC
GAGCGGCGATCGGAACGGTTGCCGACCATGACGCTGCCGTCTCCGCCGTGCCAGAGTCTCGGACAGGCTGGGATC
CAGAGGCGGCCGTTTCTGAAGTACAAGCAGCCGGTCACGACGCTCTGA
Gene >Hirsu2|7663
ATGGGTCTCGCGACGTACCAGGAGCCTGTCAGGCGGCTGGAGCAACTCCTGTACAGGCGTGCGGCCGAGCATCCT
GATGCGCCTGCCATAGAGGACGAGGGGGGCGTTGTCGATTACAGAACAGCACTATGCCGTGCCCGGACGATTGCC
TCTGGGCTCATCAGAGCCGCGTCTGAAAACGACGTGCCCTTACACCAAAACCCGACTGTGGGCATCTGCATCCAA
AGGGGGTCGAGTGCCATTGTGGCTCTCCTGGGCGCCTTGGCAGCCGGCTGCTGCTATGTCCCTCTCGCCCTGGAT
GCCGGGAGCGAGAGGCTGGCGCGGACTTTGGCGATATCCGGCATCCGGATCGTCCTCACCGACGACGCCTCTTCT
CAGGCTCTGAGCGGCAAGCTAGATGATGGACGAACCGGGGCGAGGCCGGTGCTGGTCAGCGTGGAAGCACTGCTG
GCGCAGCACGCGGACAGCGGCGCGACAGGCGCCGCGATGCCCTCGACGCCGTTCCAGAGCAGCACGGCCTACACG
CTGTTCTCGTCCGGCACGACGGGCAAGCCAAAGGGCATCAGCATGTCGCACTCCTCGGTCCTGCACTACCTGAAC
GCGAGCAGGCGCACCTTCAAGACCACGCGCCTCGACCGCTGGCTCCACGCGGCCCCGTACACCTTCGACGTCAGC
CTCGAGGAGCTCTTCGTCCCGCTCAGCGCCGGCGCCTGCATCGTCTGCCAGCCCCGGGGGGGTCTCGACTCGCTC
GCCGGCTACCTCGAGTTCATGGCCGCTTCGCACATCACGGCCGTGTCGATGCCCACGGCCTTCTGGCACCGCCTG
TCGCCGCACCTCGTCGACAGCGGCGACAGCCTCCCCAGCAGCCTCCGCCTCGTCGTCATCGGGGGAGAGGCGGCA
CGGACCGACGCATACCGGCAGTGGGCCTCGGCGGTTAGGGGCCGCGTCGAGCTTGTCAACGCCTACGGGCCGACG
GAGAGCTGCGTCTCGGCCACGTTCGGCACGCGCTTCGATCTCGCCGACACGACGTTGAGCATAGGGCGGCCCTTG
CCGGGGATGGAGGCGTACGTCGCTGAGCGCGATGCCGACGTGCTCGTGCCTGACGGCCAAGTCGGGCGTCTGCTG
CTGGCCGGGCCGCAGTTGGCTGTCGGGTACCGGGGCGACCCGGCGCTCTCGGCGACCAAGTTCTTCGCCAACCCG
TTCGAGGATTGGGTGATGCCCGGATACGAGCGCGTCTATGACACGGGGGACCTGGTTGTCCGGAAGCCGACAGGC
GAGCTTGCCTTCTGCGGCCGGGTCGACTTGCAGCTTCAGGTCCGCGGCCAGAGAGTCGAGGCCGAGGGTGTCGAG
ACCGTTCTCGCCGCCTGCGCGTCCGTCACGGAAGCTTCCATCATCGTGGTGGAGGACCAGGGATCCGAGGCCATG
GTCGCCTTTCTCGTCCCGCGCGAGGGACTGCCTGAAGAGGTTGTCGTGCCCGACGTCGAAAAGAGCTGCGCCGTC
CACCTCGTGGCTTTCGAAAAGCCTTCGCACTTTGTACTGCTGGACGAGCTGCCGCTCAACGCGAGCGGCAAGGTA
GACAAGAAAGCCTTGGCAGTCGAGTGGCATGAGCGAAGATCCAAGCCCGCCCACGCATCGATTTCACCGGTCGTC
ACCGAGACGGAAAAGTCGCTGGCCGACTTATGGCGGCAGGCACTTTCTCTGGAGCCATCGGTCCGGCTCGGCAGG
GAGAGCAGCCTCGCCAGGTTAGGCGGCCACTCCTTGACCATGGTCACCTTGACGAGCAAGATATACAGCCGATTC
AACGTCAGGGTCACCGTCCCCGAGCTTCTGCGACACCAGCAGCTGTCAGAAATGGCCGACTTCCTGGAAAGCAGG
CCGGCCAGCTCCATGGTGGAGCCATCAGCCACATTGGGAGCTGATACCGACGGCGTCTTTGACCTGACGCCGAGC
CAGGAGCAGCTGTATTTGGCTCAGAGCAAAGAGCCCGACTCTCCCTTTTTCAACGACGGCGTGGCGATCCAGATT
CAGGGGCCCTGTGACCCACAACTTCTCGAGGACGCCGCCAAGCGCATCGTGCGGCGGCATGCGGCCCTCCGATGC
GTCCTCGTTGGTACCGGAAGTTCCGGTAAGGTGCAGCAACGCGTCCTTCCGCTCAGCGGTTCTTTGTGGGAGAGC
ATCTGGAATCATCAGCTAGTTAGCCCGAACCAGCTCGAAAGGGTCAGCGCCGACTTGTTCAGTGTACCCCTCGAC
CTCTTCTCGGGGCCCTTGCTCAAGATTCACCTGCTGGAAGGCAGGCAGGAGGAGGGGGCAGGGCCGGATGCAAGG
GTATCGATCCTGATCGTACAGGCACATCACATCTGCTGGGATGGCTTCTCCGACGGTATCTTTCTTGAAGAACTC
AAGACCTTGTACCGAGACCCGGCTGCTGCGTTGGGAAACCATGCCCCCGTCATGACCACGCTCAGCCCACAGCCC
GGAGCGGCCGATGCCTCCATCGCGGAACTGGGCGATTACCTTCGCAATGTGCCCGAATCCGTCGACCTTCCGACA
GACTTGGCGCCTCCGCAGAAGAAGAGCTACAGCCGGGGCGGTGTTGTGCGGTTCGAGCTGGCTGCGGCCTTGATG
CGTCAAGCTCTTGCGTCGGCTGGACGGGATATAACGCCAACGTCGCTTTTGCTCACCGTGTACGCAGCCGTGCTT
CGGCGCTTCGCCGGCGGTCAGAGCGACCTTGCTCTAGGAGTCCCCATGGCCAACAGAGTGACGGCCGAGGCTGCG
GCGCGTATAGGCTTCTTCGTTAACATGCTTCCCCTCAGAGTCCAGGCCGAGGATGAGCACCGGCTATCCGACCTC
CTCGGCATGGTCGAAGCCGGGCTGGATACGCTGCGCAGAAACCAGGACGTGCTCCTGGCCGATGTGTACCGTCGG
CAGCAGAGCTCGAGCTCTACGCATGAACGATTGCTCAGGTTCTGCTTCTCTTTCCAGGATGCCCCCGAGGGAAAG
CTGGTCGATGGTTGCACCTTCAGGCGGTGGCCGCTTCACAACGGCGCCGCACGCGCCGACTTGACTTGCTTTACC
GAGCTCTGTATCGACGGAACCATCTCGGGCGAGCTCGAATACGATGCGGACCTCTTTGACCGCGAAACGATAGCT
TCCATCTCGGACTGCATGGTGTACGTGTTGCAGAGCATCGCCTCACATCAGGCATGGGAGAAGTCTCTGGGACAA
CTCGCTCTGGTCGAGGCCCAGCCAAAGGATGTGTTCGCCATGGGCGGCAACTTGGGCAATCAAGCAGAAGATCTC
GGCTCATACCTTCTTCGGGCTGTTGATGCTTGCGAGAAGCCCGACATTGCGATTGTCGACGAGGTTTCGGGCTGC
CGCATCACATACGGAGAGCTGTCAAAGAGGGCAAGATGTATGGCGTGCCAGATCCATGTGACAGCGTCCCGGCCA
GGGCCAGTGCTACTGCTCCTCCGGAGATCCTGGGAAGTTCCCGTCTCCCAGATGGCCTCTGCTCTGGCTGGTCGG
CCCTGGATCTGCTGCGATGTTAGCCAGCCGCGCGAAAGACTGATGCGCATCATCGATGAGGCGAATCCGGGCTGC
ATCGTCTCACAAAGCGGTATCGTTGCCGACATCCCATCCCTTTCGAACCACGGCGTTCCCATTCTCTACCCCTTG
GAGCTTTTCAACAGCGCATGGGATGCCGCTTGCGAGATTCCCCAGACGCCTCGAGAAGGCAACCTGGCCTACGTC
ATCTACACGAGTGGAACGACCGGAACGCCTAAAGGAGTGGCCATCGAGCAGCGGAGCTTCATTCAGTTCGTCGAC
CACATCCGGTCGTGGACGGCGCGACCCGGGGGTCCGACAGCATTCAACAGCATTCTCACGTCAAACACGGCGTTC
GACGGATCCCTGTCCCAGATGTACTCGGCGCTCACGACCGGCGGAAGGCTCATCATCACCAAACATGGGGGCGAG
CAGGACGGAGAGTACGTGGCCGCGACGCTGAGCAAGCACGACATCAACTACCTCTGCACCACCACGGCCGCTGTC
CGCCTGTGGATGAGCCAGGCCTCACAGTCGCACCCCGAGTTCTTCGGGCCGCACTTCCGATGCCTTCTCCTCGGT
GGGGATGAGCTTCCTCCCGTATTCTTGTCGACCATATTCGCGCGATCGAGTTGCCCCGAAAAGGTCGAGGTGAAG
AACGTGTACGGCCCTACCGAAGGCACCATCTTCTCGTCATATGGCGATTACAGGGCGTCCGACTTGAGCTGGCTC
AGGGGCAGACGCCGGAGCCCGATCGATACGACGTTGCCGAGCGCGGCCATCTCCGTCGTGGGCCCAGACCTGCGA
GACCTTCCCAGGGGCGCCGTGGGCGAGATCGTCATATGGGGTTCGTGTCTGGCCAGAGAGTATCTCGACCTGCCC
GAGCTAAATGCGGTCAAGTTCGTCAGCCGCGGCCAGTTGCGGGGGTGGAGGACTGGAGATCTCGGGAGGTGGACC
GGCTCAGGCGGCGGTGGTGCTTTTGAGGTGCTGGGCAGGGCCGATTCGATGCGCAAGGTCCTGGGCGGCTTTCGG
GTCGACCTGGACGAGGTCGGGCTGGCCGTGGCCAGCCACGCAGAGGTCCGCGAATGCCACGTCTCGACCGTGGAG
GAAGAAGACGAAGAAGGCGCCAGACAGACCAAGGTGGTGGCTCACGTCGTCTTGCACCAGCAGCAGCGAGAGCAG
CAAGACCTCGAGACGGTTTCCAACTGGCGAACCATGTTCACCGATGTCAACCACAGTCTCGAGGAGTACGACGAC
GAGGGCATCGACCTGGCCTTTGACTACCGCGGCTGGGCCTCAAGCTTCGACCGGAGCACCATCCCCAAGTCCGAG
ATGGAGGAATGGGTCAGCTGCACCGTGGACCGCATTCTCGATCTGGATTGCTTCCAGGGAGGGAAGAGGCCGCGG
GTTGCCGAGATAGGCTGCGGCACCGGCATGATCGTCTTCCGCCTCGCCGACAAGGTCAGCAGCTACTACGGCACA
GACTTGGCCGAGTCCACGGTGGCCCAGGTGCAGCGACATGCAGGAAGCCTGGGCCACAAGCACATCCAGACACGG
GCGCTGCCGGCGCACGAGTTCGATAACCTGCTGCCCGAGAGTGAGCGCTTCGACCTCATCATCTGCAACTCGGTG
GCCCAGTATTTCCCGTCTCTCGACTACCTCGAGCAGGTGCTCAGGCGAGCCCGCAGCAGGCTGAACCCCGGCGGG
CTGCTCTTCATGGGCGATATCCGCCATGAGGGACTCAAGACGCACCACGCCGTCACGTCGGCGTTTTCCAGGGGA
GCTCGAACAGCCGCGGCGCTGCGGCTGTCCGCAGTCGACATCCTGGAGAAGGATCGAGAGCTTCAGGTCGACCCG
TCCTTCTTTGTGGACCGGTGCGGCGCAATTGACCGGCTCTTCCAAGGGCGTGCGAGGATCGAGTGGAGGAGAGGG
TCGGCTCCGACGGAGATGACGCTGTTCCGGTAATGCTTCCCCAGGTAACTCCATAGGTTGGATGGGCCTAGGCTA
ACGTTGACCGACTTTCAGATACGATGCGGTGCTTATGGCGGTGGCCCAGGAAGCGGAAGCGGGCGAGCGGCGATC
GGAACGGTGTATCGCGTGGGAGAAGCAGTATCAGCTCTCTGAGATTCACACCCTTCTCCCATCCGACGGTGACAT
CGTTATTCTCCAAGACATCCCGAATCAGCGTCTCCAGCTGTCGGAGCATTTGAGAAGTTTTCTGGTTCCCAGTGC
CGACCATGACGCTGCCGTCTCCGCCGTGCCAGAGTCTCGGACAGGCTGGGATCCAGAGGCGGCCGTTTCTGAAGT
ACAAGCAGCCGGTCACGACGCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail