Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7662
Gene name
LocationContig_459:3643..5395
Strand-
Gene length (bp)1752
Transcript length (bp)1668
Coding sequence length (bp)1668
Protein length (aa) 556

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00550 PP-binding Phosphopantetheine attachment site 9.3E-08 83 148
PF00975 Thioesterase Thioesterase domain 1.0E-07 263 320

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 2 148 3.0E-12
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 7 148 1.0E-09
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2 166 2.0E-09
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 6 140 5.0E-09
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 7 162 9.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 2 148 3.0E-12
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 7 148 1.0E-09
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2 166 2.0E-09
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 6 140 5.0E-09
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 7 162 9.0E-09
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 3 148 9.0E-09
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 7 148 2.0E-08
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3 145 6.0E-08
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 6 153 7.0E-08
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 3 148 8.0E-08
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 6 158 1.0E-07
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 6 158 1.0E-07
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 5 162 1.0E-07
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 7 148 1.0E-07
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 3 152 3.0E-07
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 6 150 5.0E-07
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 3 179 5.0E-07
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 3 161 7.0E-07
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2 145 9.0E-07
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 3 145 1.0E-06
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2 152 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7662
MHLFHKVPRYMIPHYMVSVDSLPLAGTGKVNVKLLPSPQPSDLLSGAVSAQDGLQNGDGNSEGADSKPGETKLSS
DILPLARDIAAIFSEALGRRCSVHDDFFFSGGHSILAARAVQMMRARLGGGGLAVPFTAILAHPTPAALAARLVD
MRRWRDQGGDLPAPLVLLRPATAASLSKEEDGGGFEERREGQKQSLPMDIVVMHPIGGGLMPMAGLADALGERLR
GEARIIGLPWTSTSGGGGGNRRGELASTRREEDGEEISSPQTVEALAERYAEILADFISARSRGEAHDSDRPLYL
LGWSFGGTLAYEAAKRLQSMRVAQGRGEESSVQVVLLDAPTLDAAVRELEPCSLVAENYAEHMVDYIAERTRSSS
ATASSPELKRSTAQGQGQSDQIQSLRRLLRHSRFDEHTNLSALAPLVRECYDKSLGIPSWITDADLVESSRGLQA
NLQALCGSSHARRSGGHGEGGRQKGAALIADGGRARLAVLHVQATRGLGARLPDADLGWEAERRLQAGRLVWTKH
EVETGHDDVLVSAVDLVADHISTTVGMNQD*
Coding >Hirsu2|7662
ATGCACTTGTTCCATAAAGTGCCGCGCTATATGATACCGCATTATATGGTTTCCGTCGACAGCCTGCCCCTCGCA
GGGACTGGCAAGGTCAACGTCAAGCTGCTCCCATCACCACAGCCCAGTGACCTGCTCAGCGGAGCCGTATCGGCG
CAGGACGGGCTGCAAAACGGAGACGGGAACTCCGAGGGCGCCGATAGCAAGCCCGGCGAGACAAAACTCTCCAGC
GACATCCTGCCGCTGGCGCGCGATATCGCGGCCATCTTCAGTGAGGCGCTCGGCCGTCGCTGCTCCGTGCACGAC
GACTTCTTCTTCAGCGGCGGCCACTCTATCCTAGCGGCACGCGCGGTGCAGATGATGCGTGCGCGCTTAGGCGGC
GGAGGCCTCGCGGTGCCTTTCACAGCCATCCTGGCCCATCCAACACCAGCGGCGCTGGCGGCGCGCCTGGTCGAC
ATGCGCCGCTGGCGGGACCAGGGTGGCGATCTGCCGGCGCCCTTGGTGCTGCTTCGGCCTGCCACGGCTGCGTCT
TTGAGCAAGGAAGAGGATGGCGGGGGCTTTGAGGAGAGGAGAGAAGGGCAGAAGCAAAGTCTCCCGATGGACATT
GTCGTCATGCATCCCATCGGAGGCGGCCTGATGCCCATGGCTGGACTGGCCGATGCCCTGGGCGAGCGGCTCCGG
GGGGAGGCCCGGATCATCGGGCTGCCATGGACCAGCACATCAGGTGGTGGCGGCGGTAACAGACGTGGCGAACTT
GCTTCGACGCGGAGGGAGGAAGACGGAGAAGAAATTTCCTCCCCACAGACAGTCGAGGCCCTCGCAGAGAGATAT
GCAGAGATCTTGGCCGATTTCATCAGTGCGCGCAGCAGAGGGGAAGCCCACGACTCCGACCGGCCGCTGTACTTG
CTCGGCTGGAGCTTCGGAGGCACGCTGGCTTACGAGGCGGCCAAGCGTCTACAGTCCATGCGGGTCGCGCAAGGA
CGGGGGGAGGAGAGCAGTGTGCAGGTCGTCCTGCTCGACGCCCCGACTCTCGACGCTGCAGTGCGCGAGCTGGAG
CCCTGCAGCCTGGTCGCCGAGAACTATGCCGAGCACATGGTCGATTATATCGCGGAGCGCACCCGCAGCAGCAGC
GCCACCGCCTCGTCGCCCGAGTTGAAACGGTCGACGGCTCAGGGCCAGGGCCAGAGCGATCAAATCCAGAGTCTG
AGGCGGCTCCTCAGGCACAGCCGGTTCGACGAACACACGAACCTGTCAGCCCTCGCGCCGTTGGTGCGCGAATGC
TACGACAAGTCGCTCGGCATCCCGTCCTGGATCACAGACGCGGACCTTGTCGAGTCGTCGCGCGGCTTGCAGGCG
AACTTGCAGGCCCTCTGCGGCAGCAGTCACGCAAGGCGGTCCGGAGGTCATGGCGAGGGCGGCAGACAGAAGGGA
GCCGCTTTAATCGCCGACGGTGGGCGGGCGAGGCTGGCGGTTTTGCATGTGCAGGCCACCCGCGGCCTGGGCGCT
CGGCTGCCCGACGCCGATCTTGGATGGGAGGCCGAGCGTCGGCTCCAGGCGGGGAGGCTGGTCTGGACGAAACAT
GAGGTCGAGACGGGCCATGATGATGTGCTTGTTTCCGCGGTCGATCTCGTGGCGGATCATATCAGCACAACGGTT
GGGATGAACCAAGACTGA
Transcript >Hirsu2|7662
ATGCACTTGTTCCATAAAGTGCCGCGCTATATGATACCGCATTATATGGTTTCCGTCGACAGCCTGCCCCTCGCA
GGGACTGGCAAGGTCAACGTCAAGCTGCTCCCATCACCACAGCCCAGTGACCTGCTCAGCGGAGCCGTATCGGCG
CAGGACGGGCTGCAAAACGGAGACGGGAACTCCGAGGGCGCCGATAGCAAGCCCGGCGAGACAAAACTCTCCAGC
GACATCCTGCCGCTGGCGCGCGATATCGCGGCCATCTTCAGTGAGGCGCTCGGCCGTCGCTGCTCCGTGCACGAC
GACTTCTTCTTCAGCGGCGGCCACTCTATCCTAGCGGCACGCGCGGTGCAGATGATGCGTGCGCGCTTAGGCGGC
GGAGGCCTCGCGGTGCCTTTCACAGCCATCCTGGCCCATCCAACACCAGCGGCGCTGGCGGCGCGCCTGGTCGAC
ATGCGCCGCTGGCGGGACCAGGGTGGCGATCTGCCGGCGCCCTTGGTGCTGCTTCGGCCTGCCACGGCTGCGTCT
TTGAGCAAGGAAGAGGATGGCGGGGGCTTTGAGGAGAGGAGAGAAGGGCAGAAGCAAAGTCTCCCGATGGACATT
GTCGTCATGCATCCCATCGGAGGCGGCCTGATGCCCATGGCTGGACTGGCCGATGCCCTGGGCGAGCGGCTCCGG
GGGGAGGCCCGGATCATCGGGCTGCCATGGACCAGCACATCAGGTGGTGGCGGCGGTAACAGACGTGGCGAACTT
GCTTCGACGCGGAGGGAGGAAGACGGAGAAGAAATTTCCTCCCCACAGACAGTCGAGGCCCTCGCAGAGAGATAT
GCAGAGATCTTGGCCGATTTCATCAGTGCGCGCAGCAGAGGGGAAGCCCACGACTCCGACCGGCCGCTGTACTTG
CTCGGCTGGAGCTTCGGAGGCACGCTGGCTTACGAGGCGGCCAAGCGTCTACAGTCCATGCGGGTCGCGCAAGGA
CGGGGGGAGGAGAGCAGTGTGCAGGTCGTCCTGCTCGACGCCCCGACTCTCGACGCTGCAGTGCGCGAGCTGGAG
CCCTGCAGCCTGGTCGCCGAGAACTATGCCGAGCACATGGTCGATTATATCGCGGAGCGCACCCGCAGCAGCAGC
GCCACCGCCTCGTCGCCCGAGTTGAAACGGTCGACGGCTCAGGGCCAGGGCCAGAGCGATCAAATCCAGAGTCTG
AGGCGGCTCCTCAGGCACAGCCGGTTCGACGAACACACGAACCTGTCAGCCCTCGCGCCGTTGGTGCGCGAATGC
TACGACAAGTCGCTCGGCATCCCGTCCTGGATCACAGACGCGGACCTTGTCGAGTCGTCGCGCGGCTTGCAGGCG
AACTTGCAGGCCCTCTGCGGCAGCAGTCACGCAAGGCGGTCCGGAGGTCATGGCGAGGGCGGCAGACAGAAGGGA
GCCGCTTTAATCGCCGACGGTGGGCGGGCGAGGCTGGCGGTTTTGCATGTGCAGGCCACCCGCGGCCTGGGCGCT
CGGCTGCCCGACGCCGATCTTGGATGGGAGGCCGAGCGTCGGCTCCAGGCGGGGAGGCTGGTCTGGACGAAACAT
GAGGTCGAGACGGGCCATGATGATGTGCTTGTTTCCGCGGTCGATCTCGTGGCGGATCATATCAGCACAACGGTT
GGGATGAACCAAGACTGA
Gene >Hirsu2|7662
ATGCACTTGTTCCATAAAGTGCCGCGCTATGTAAGTGGCCGACTTCAATCCTGATTCTTGCTCCGTCATGCTCAT
ATCGCTGGCGCGGCGTCGGCTAATGCGTGCCCGTGGCAGATGATACCGCATTATATGGTTTCCGTCGACAGCCTG
CCCCTCGCAGGGACTGGCAAGGTCAACGTCAAGCTGCTCCCATCACCACAGCCCAGTGACCTGCTCAGCGGAGCC
GTATCGGCGCAGGACGGGCTGCAAAACGGAGACGGGAACTCCGAGGGCGCCGATAGCAAGCCCGGCGAGACAAAA
CTCTCCAGCGACATCCTGCCGCTGGCGCGCGATATCGCGGCCATCTTCAGTGAGGCGCTCGGCCGTCGCTGCTCC
GTGCACGACGACTTCTTCTTCAGCGGCGGCCACTCTATCCTAGCGGCACGCGCGGTGCAGATGATGCGTGCGCGC
TTAGGCGGCGGAGGCCTCGCGGTGCCTTTCACAGCCATCCTGGCCCATCCAACACCAGCGGCGCTGGCGGCGCGC
CTGGTCGACATGCGCCGCTGGCGGGACCAGGGTGGCGATCTGCCGGCGCCCTTGGTGCTGCTTCGGCCTGCCACG
GCTGCGTCTTTGAGCAAGGAAGAGGATGGCGGGGGCTTTGAGGAGAGGAGAGAAGGGCAGAAGCAAAGTCTCCCG
ATGGACATTGTCGTCATGCATCCCATCGGAGGCGGCCTGATGCCCATGGCTGGACTGGCCGATGCCCTGGGCGAG
CGGCTCCGGGGGGAGGCCCGGATCATCGGGCTGCCATGGACCAGCACATCAGGTGGTGGCGGCGGTAACAGACGT
GGCGAACTTGCTTCGACGCGGAGGGAGGAAGACGGAGAAGAAATTTCCTCCCCACAGACAGTCGAGGCCCTCGCA
GAGAGATATGCAGAGATCTTGGCCGATTTCATCAGTGCGCGCAGCAGAGGGGAAGCCCACGACTCCGACCGGCCG
CTGTACTTGCTCGGCTGGAGCTTCGGAGGCACGCTGGCTTACGAGGCGGCCAAGCGTCTACAGTCCATGCGGGTC
GCGCAAGGACGGGGGGAGGAGAGCAGTGTGCAGGTCGTCCTGCTCGACGCCCCGACTCTCGACGCTGCAGTGCGC
GAGCTGGAGCCCTGCAGCCTGGTCGCCGAGAACTATGCCGAGCACATGGTCGATTATATCGCGGAGCGCACCCGC
AGCAGCAGCGCCACCGCCTCGTCGCCCGAGTTGAAACGGTCGACGGCTCAGGGCCAGGGCCAGAGCGATCAAATC
CAGAGTCTGAGGCGGCTCCTCAGGCACAGCCGGTTCGACGAACACACGAACCTGTCAGCCCTCGCGCCGTTGGTG
CGCGAATGCTACGACAAGTCGCTCGGCATCCCGTCCTGGATCACAGACGCGGACCTTGTCGAGTCGTCGCGCGGC
TTGCAGGCGAACTTGCAGGCCCTCTGCGGCAGCAGTCACGCAAGGCGGTCCGGAGGTCATGGCGAGGGCGGCAGA
CAGAAGGGAGCCGCTTTAATCGCCGACGGTGGGCGGGCGAGGCTGGCGGTTTTGCATGTGCAGGCCACCCGCGGC
CTGGGCGCTCGGCTGCCCGACGCCGATCTTGGATGGGAGGCCGAGCGTCGGCTCCAGGCGGGGAGGCTGGTCTGG
ACGAAACATGAGGTCGAGACGGGCCATGATGATGTGCTTGTTTCCGCGGTCGATCTCGTGGCGGATCATATCAGC
ACAACGGTTGGGATGAACCAAGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail