Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7658
Gene name
LocationContig_458:13300..17212
Strand+
Gene length (bp)3912
Transcript length (bp)3831
Coding sequence length (bp)3831
Protein length (aa) 1277

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06479 Ribonuc_2-5A Ribonuclease 2-5A 2.0E-41 1144 1271
PF00069 Pkinase Protein kinase domain 1.0E-28 844 1023
PF00069 Pkinase Protein kinase domain 5.8E-09 1054 1138
PF07714 Pkinase_Tyr Protein tyrosine kinase 3.4E-19 843 1134

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94537|PPK4_SCHPO Serine/threonine-protein kinase ppk4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk4 PE=3 SV=1 838 1272 1.0E-113
sp|P32361|IRE1_YEAST Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRE1 PE=1 SV=2 764 1256 3.0E-107
sp|Q9EQY0|ERN1_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Mus musculus GN=Ern1 PE=1 SV=1 805 1271 6.0E-84
sp|Q09499|IRE1_CAEEL Serine/threonine-protein kinase/endoribonuclease ire-1 OS=Caenorhabditis elegans GN=ire-1 PE=1 SV=2 848 1271 9.0E-83
sp|O75460|ERN1_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Homo sapiens GN=ERN1 PE=1 SV=2 834 1249 1.0E-82
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94537|PPK4_SCHPO Serine/threonine-protein kinase ppk4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk4 PE=3 SV=1 838 1272 1.0E-113
sp|P32361|IRE1_YEAST Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRE1 PE=1 SV=2 764 1256 3.0E-107
sp|Q9EQY0|ERN1_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Mus musculus GN=Ern1 PE=1 SV=1 805 1271 6.0E-84
sp|Q09499|IRE1_CAEEL Serine/threonine-protein kinase/endoribonuclease ire-1 OS=Caenorhabditis elegans GN=ire-1 PE=1 SV=2 848 1271 9.0E-83
sp|O75460|ERN1_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Homo sapiens GN=ERN1 PE=1 SV=2 834 1249 1.0E-82
sp|Q9Z2E3|ERN2_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Mus musculus GN=Ern2 PE=2 SV=2 837 1274 3.0E-81
sp|Q76MJ5|ERN2_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Homo sapiens GN=ERN2 PE=1 SV=4 837 1250 9.0E-81
sp|Q9C5S2|IRE1A_ARATH Serine/threonine-protein kinase/endoribonuclease IRE1a OS=Arabidopsis thaliana GN=IRE1A PE=1 SV=1 836 1272 3.0E-74
sp|Q55GJ2|IREA_DICDI Probable serine/threonine-protein kinase ireA OS=Dictyostelium discoideum GN=ireA PE=3 SV=1 835 1271 2.0E-72
sp|Q93VJ2|IRE1B_ARATH Serine/threonine-protein kinase/endoribonuclease IRE1b OS=Arabidopsis thaliana GN=IRE1B PE=2 SV=1 836 1268 2.0E-67
sp|Q9SF12|IRE1L_ARATH Inactive serine/threonine-protein kinase/endoribonuclease IRE1-like OS=Arabidopsis thaliana GN=At3g11870 PE=3 SV=1 759 1271 7.0E-39
sp|Q557G1|IRLB_DICDI Probable serine/threonine-protein kinase irlB OS=Dictyostelium discoideum GN=irlB-1 PE=3 SV=1 835 1228 6.0E-35
sp|Q54IE8|IRLE_DICDI Probable serine/threonine-protein kinase irlE OS=Dictyostelium discoideum GN=irlE PE=3 SV=1 825 1148 7.0E-34
sp|Q559A2|IRLA_DICDI Probable serine/threonine-protein kinase irlA OS=Dictyostelium discoideum GN=irlA PE=3 SV=1 845 1250 4.0E-33
sp|Q55DJ8|IRLC_DICDI Probable serine/threonine-protein kinase irlC OS=Dictyostelium discoideum GN=irlC PE=3 SV=1 835 1148 5.0E-33
sp|Q55DJ9|IRLD_DICDI Probable serine/threonine-protein kinase irlD OS=Dictyostelium discoideum GN=irlD PE=3 SV=1 848 1148 3.0E-32
sp|Q556Q3|IRLF_DICDI Probable serine/threonine-protein kinase irlF OS=Dictyostelium discoideum GN=irlF-1 PE=3 SV=1 834 1222 1.0E-30
sp|P32361|IRE1_YEAST Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRE1 PE=1 SV=2 201 566 9.0E-22
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 845 1212 6.0E-20
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 848 1138 6.0E-20
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 882 1195 1.0E-19
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 846 1138 2.0E-18
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 843 1138 4.0E-18
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 860 1138 4.0E-18
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 843 1138 4.0E-18
sp|Q80YP0|CDK3_MOUSE Cyclin-dependent kinase 3 OS=Mus musculus GN=Cdk3 PE=1 SV=2 846 1140 6.0E-18
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 887 1138 1.0E-17
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 846 1137 2.0E-17
sp|P15735|PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens GN=PHKG2 PE=1 SV=1 861 1138 2.0E-17
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 848 1138 2.0E-17
sp|Q16816|PHKG1_HUMAN Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Homo sapiens GN=PHKG1 PE=2 SV=3 882 1138 2.0E-17
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 863 1135 2.0E-17
sp|Q5RCC4|KCC2A_PONAB Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Pongo abelii GN=CAMK2A PE=2 SV=2 841 1138 2.0E-17
sp|Q9UQM7|KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens GN=CAMK2A PE=1 SV=2 841 1138 2.0E-17
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 846 1138 3.0E-17
sp|Q13555|KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens GN=CAMK2G PE=1 SV=3 862 1137 3.0E-17
sp|Q9DB30|PHKG2_MOUSE Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Mus musculus GN=Phkg2 PE=2 SV=2 861 1138 3.0E-17
sp|P11275|KCC2A_RAT Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Rattus norvegicus GN=Camk2a PE=1 SV=1 841 1138 3.0E-17
sp|P11798|KCC2A_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus GN=Camk2a PE=1 SV=2 841 1138 3.0E-17
sp|Q2KJ16|PHKG2_BOVIN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Bos taurus GN=PHKG2 PE=2 SV=1 861 1138 3.0E-17
sp|O77708|KCC2D_RABIT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Oryctolagus cuniculus GN=CAMK2D PE=2 SV=2 862 1138 4.0E-17
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 881 1138 4.0E-17
sp|Q923T9|KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus GN=Camk2g PE=1 SV=1 884 1137 5.0E-17
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 862 1138 5.0E-17
sp|P15791|KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus GN=Camk2d PE=1 SV=1 862 1138 5.0E-17
sp|Q95266|KCC2D_PIG Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Sus scrofa GN=CAMK2D PE=2 SV=1 884 1138 5.0E-17
sp|Q6PHZ2|KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus GN=Camk2d PE=1 SV=1 884 1138 6.0E-17
sp|Q13557|KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens GN=CAMK2D PE=1 SV=3 884 1138 6.0E-17
sp|Q2HJF7|KCC2D_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus GN=CAMK2D PE=2 SV=1 884 1138 6.0E-17
sp|P51958|CDK1_CARAU Cyclin-dependent kinase 1 OS=Carassius auratus GN=cdk1 PE=2 SV=1 846 1138 6.0E-17
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 821 1138 7.0E-17
sp|P11730|KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus GN=Camk2g PE=1 SV=1 884 1137 9.0E-17
sp|Q5ZKI0|KCC2D_CHICK Calcium/calmodulin-dependent protein kinase type II delta chain OS=Gallus gallus GN=CAMK2D PE=2 SV=1 841 1138 9.0E-17
sp|Q6RET6|CCAMK_PEA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase (Fragment) OS=Pisum sativum GN=SYM9 PE=1 SV=2 885 1144 9.0E-17
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 881 1135 1.0E-16
sp|P00518|PHKG1_RABIT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Oryctolagus cuniculus GN=PHKG1 PE=1 SV=2 859 1149 1.0E-16
sp|P35567|CDK1A_XENLA Cyclin-dependent kinase 1-A OS=Xenopus laevis GN=cdk1-a PE=1 SV=1 841 1138 2.0E-16
sp|Q12701|KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksg1 PE=1 SV=2 778 1138 2.0E-16
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 845 1138 2.0E-16
sp|Q9DG02|KCC2D_XENLA Calcium/calmodulin-dependent protein kinase type II delta chain OS=Xenopus laevis GN=camk2d PE=2 SV=1 841 1138 2.0E-16
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 848 1138 3.0E-16
sp|P24033|CDK1B_XENLA Cyclin-dependent kinase 1-B OS=Xenopus laevis GN=cdk1-b PE=1 SV=2 841 1138 3.0E-16
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 881 1138 3.0E-16
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 847 1138 3.0E-16
sp|Q6DGS3|KC2D2_DANRE Calcium/calmodulin-dependent protein kinase type II delta 2 chain OS=Danio rerio GN=camk2d2 PE=2 SV=2 841 1138 3.0E-16
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 848 1138 4.0E-16
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 846 1135 4.0E-16
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 843 1135 4.0E-16
sp|Q9QYK9|KCC1B_MOUSE Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus GN=Pnck PE=1 SV=1 879 1135 4.0E-16
sp|P07934|PHKG1_MOUSE Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Mus musculus GN=Phkg1 PE=1 SV=3 859 1149 5.0E-16
sp|Q00526|CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens GN=CDK3 PE=1 SV=1 846 1142 5.0E-16
sp|Q26671|CDC2H_THEAN Cell division control protein 2 homolog OS=Theileria annulata GN=CRK2 PE=2 SV=1 846 1138 5.0E-16
sp|P31325|PHKG2_RAT Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Rattus norvegicus GN=Phkg2 PE=1 SV=1 861 1138 6.0E-16
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 893 1138 6.0E-16
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 893 1138 7.0E-16
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 893 1138 7.0E-16
sp|A0AAR7|CCAMK_LOTJA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lotus japonicus GN=CCAMK PE=1 SV=1 885 1136 7.0E-16
sp|Q54SJ5|MYLKC_DICDI Probable myosin light chain kinase DDB_G0282429 OS=Dictyostelium discoideum GN=DDB_G0282429 PE=3 SV=1 861 1137 7.0E-16
sp|Q00168|KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster GN=CaMKII PE=1 SV=1 862 1138 7.0E-16
sp|Q10292|MEK1_SCHPO Meiosis-specific serine/threonine-protein kinase mek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mek1 PE=3 SV=1 844 1146 8.0E-16
sp|Q9DGD3|CDK1_ORYLA Cyclin-dependent kinase 1 OS=Oryzias latipes GN=cdk1 PE=2 SV=1 846 1138 8.0E-16
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 751 1136 1.0E-15
sp|Q27032|CDC2H_THEPA Cell division control protein 2 homolog OS=Theileria parva GN=CRK2 PE=3 SV=1 846 1138 1.0E-15
sp|P39951|CDK1_RAT Cyclin-dependent kinase 1 OS=Rattus norvegicus GN=Cdk1 PE=1 SV=1 846 1138 1.0E-15
sp|P13286|PHKG1_RAT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Rattus norvegicus GN=Phkg1 PE=2 SV=2 859 1149 1.0E-15
sp|Q13554|KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens GN=CAMK2B PE=1 SV=3 856 1137 1.0E-15
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 848 1138 1.0E-15
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 881 1138 1.0E-15
sp|Q9DG98|CDK1_ORYLU Cyclin-dependent kinase 1 OS=Oryzias luzonensis GN=cdk1 PE=2 SV=1 846 1138 1.0E-15
sp|Q9DGA2|CDK1_ORYJA Cyclin-dependent kinase 1 OS=Oryzias javanicus GN=cdk1 PE=2 SV=1 846 1138 1.0E-15
sp|Q9DGA5|CDK1_ORYCU Cyclin-dependent kinase 1 OS=Oryzias curvinotus GN=cdk1 PE=2 SV=1 846 1138 1.0E-15
sp|Q04859|MAK_MOUSE Serine/threonine-protein kinase MAK OS=Mus musculus GN=Mak PE=1 SV=2 844 1138 1.0E-15
sp|P20794|MAK_HUMAN Serine/threonine-protein kinase MAK OS=Homo sapiens GN=MAK PE=1 SV=2 844 1138 1.0E-15
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 881 1136 2.0E-15
sp|Q6Z829|WEE1_ORYSJ Wee1-like protein kinase OS=Oryza sativa subsp. japonica GN=WEE1 PE=3 SV=1 846 1138 2.0E-15
sp|P06493|CDK1_HUMAN Cyclin-dependent kinase 1 OS=Homo sapiens GN=CDK1 PE=1 SV=3 846 1138 2.0E-15
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 878 1137 2.0E-15
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 778 1136 2.0E-15
sp|Q6RET7|CCAMK_MEDTR Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3 OS=Medicago truncatula GN=DMI3 PE=2 SV=1 850 1136 2.0E-15
sp|Q12852|M3K12_HUMAN Mitogen-activated protein kinase kinase kinase 12 OS=Homo sapiens GN=MAP3K12 PE=1 SV=2 841 1135 2.0E-15
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 846 1148 2.0E-15
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 878 1137 2.0E-15
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 840 1137 3.0E-15
sp|Q91YA2|KPSH1_MOUSE Serine/threonine-protein kinase H1 OS=Mus musculus GN=Pskh1 PE=2 SV=3 878 1137 3.0E-15
sp|P20793|MAK_RAT Serine/threonine-protein kinase MAK OS=Rattus norvegicus GN=Mak PE=1 SV=2 844 1138 3.0E-15
sp|P08413|KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus GN=Camk2b PE=1 SV=1 856 1137 3.0E-15
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 832 1136 3.0E-15
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 845 1138 3.0E-15
sp|P28652|KCC2B_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Mus musculus GN=Camk2b PE=1 SV=2 856 1137 3.0E-15
sp|P48734|CDK1_BOVIN Cyclin-dependent kinase 1 OS=Bos taurus GN=CDK1 PE=2 SV=2 846 1138 3.0E-15
sp|Q60700|M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus GN=Map3k12 PE=1 SV=1 841 1135 4.0E-15
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 834 1140 4.0E-15
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 846 1138 4.0E-15
sp|Q15831|STK11_HUMAN Serine/threonine-protein kinase STK11 OS=Homo sapiens GN=STK11 PE=1 SV=1 880 1138 4.0E-15
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 883 1138 5.0E-15
sp|P11440|CDK1_MOUSE Cyclin-dependent kinase 1 OS=Mus musculus GN=Cdk1 PE=1 SV=3 846 1138 5.0E-15
sp|Q91604|STK11_XENLA Serine/threonine-protein kinase stk11 OS=Xenopus laevis GN=stk11 PE=1 SV=1 880 1138 5.0E-15
sp|Q5RCH1|CDK1_PONAB Cyclin-dependent kinase 1 OS=Pongo abelii GN=CDK1 PE=2 SV=1 846 1138 5.0E-15
sp|Q63796|M3K12_RAT Mitogen-activated protein kinase kinase kinase 12 OS=Rattus norvegicus GN=Map3k12 PE=1 SV=1 841 1135 6.0E-15
sp|Q3MHJ9|KCC2B_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Bos taurus GN=CAMK2B PE=2 SV=1 856 1137 6.0E-15
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 848 1170 6.0E-15
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 845 1135 7.0E-15
sp|Q6DEH3|KC2D1_DANRE Calcium/calmodulin-dependent protein kinase type II delta 1 chain OS=Danio rerio GN=camk2d1 PE=2 SV=2 841 1138 7.0E-15
sp|Q9LJL9|CAMK2_ARATH CDPK-related kinase 2 OS=Arabidopsis thaliana GN=CRK2 PE=1 SV=1 842 1143 7.0E-15
sp|Q9W739|CDK1_RANDY Cyclin-dependent kinase 1 OS=Rana dybowskii GN=CDK1 PE=2 SV=1 846 1138 8.0E-15
sp|Q43531|CCAMK_LILLO Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lilium longiflorum GN=CCAMK PE=1 SV=1 885 1136 8.0E-15
sp|Q5E9Y0|CDK2_BOVIN Cyclin-dependent kinase 2 OS=Bos taurus GN=CDK2 PE=2 SV=1 846 1138 9.0E-15
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 848 1138 9.0E-15
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 841 1138 9.0E-15
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 881 1143 1.0E-14
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 848 1138 1.0E-14
sp|Q04770|CDK2_ENTHI Cell division protein kinase 2 homolog OS=Entamoeba histolytica GN=CDC2 PE=3 SV=1 846 1143 1.0E-14
sp|P23111|CDC2_MAIZE Cell division control protein 2 homolog OS=Zea mays GN=CDC2 PE=2 SV=1 846 1138 1.0E-14
sp|Q4Z6R1|CDC2H_PLABA Cell division control protein 2 homolog OS=Plasmodium berghei (strain Anka) GN=CRK2 PE=2 SV=1 846 1138 1.0E-14
sp|Q07250|KCCS_MALDO Calcium/calmodulin-dependent serine/threonine-protein kinase OS=Malus domestica PE=2 SV=1 893 1137 1.0E-14
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 883 1138 1.0E-14
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 879 1141 2.0E-14
sp|Q7RM49|CDC2H_PLAYO Cell division control protein 2 homolog OS=Plasmodium yoelii yoelii GN=CRK2 PE=3 SV=1 846 1138 2.0E-14
sp|Q4Y4B1|CDC2H_PLACH Cell division control protein 2 homolog OS=Plasmodium chabaudi GN=CRK2 PE=3 SV=1 846 1138 2.0E-14
sp|O15075|DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens GN=DCLK1 PE=1 SV=2 879 1170 2.0E-14
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 847 1138 2.0E-14
sp|P48963|CDK2_MESAU Cyclin-dependent kinase 2 OS=Mesocricetus auratus GN=CDK2 PE=2 SV=1 846 1138 2.0E-14
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 788 1138 2.0E-14
sp|Q1ZXH2|FHKB_DICDI Probable serine/threonine-protein kinase fhkB OS=Dictyostelium discoideum GN=fhkB PE=3 SV=1 850 1166 2.0E-14
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 881 1138 2.0E-14
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 881 1138 2.0E-14
sp|O55076|CDK2_CRIGR Cyclin-dependent kinase 2 OS=Cricetulus griseus GN=CDK2 PE=2 SV=1 846 1138 2.0E-14
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 954 1166 2.0E-14
sp|P29618|CDKA1_ORYSJ Cyclin-dependent kinase A-1 OS=Oryza sativa subsp. japonica GN=CDKA-1 PE=1 SV=1 846 1138 2.0E-14
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 834 1140 2.0E-14
sp|O08875|DCLK1_RAT Serine/threonine-protein kinase DCLK1 OS=Rattus norvegicus GN=Dclk1 PE=1 SV=1 879 1170 2.0E-14
sp|O54863|TSSK2_MOUSE Testis-specific serine/threonine-protein kinase 2 OS=Mus musculus GN=Tssk2 PE=1 SV=2 892 1142 3.0E-14
sp|P53681|CRK_DAUCA CDPK-related protein kinase OS=Daucus carota GN=CRK PE=2 SV=1 841 1135 3.0E-14
sp|P24941|CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens GN=CDK2 PE=1 SV=2 846 1138 3.0E-14
sp|Q9LX30|GCN2_ARATH Probable serine/threonine-protein kinase GCN2 OS=Arabidopsis thaliana GN=GCN2 PE=2 SV=2 848 1151 3.0E-14
sp|O80673|CAMK1_ARATH CDPK-related kinase 1 OS=Arabidopsis thaliana GN=CRK1 PE=1 SV=1 860 1138 4.0E-14
sp|Q63699|CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus GN=Cdk2 PE=1 SV=1 846 1138 4.0E-14
sp|A7J1T0|M313B_XENLA Mitogen-activated protein kinase kinase kinase 13-B OS=Xenopus laevis GN=map3k13-b PE=2 SV=1 841 1135 4.0E-14
sp|Q38772|CDC2A_ANTMA Cell division control protein 2 homolog A OS=Antirrhinum majus GN=CDC2A PE=2 SV=2 846 1138 5.0E-14
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 832 1146 5.0E-14
sp|Q9P7I2|KCC1_SCHPO Calcium/calmodulin-dependent protein kinase type I OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk1 PE=1 SV=1 848 1138 5.0E-14
sp|A7SNN5|PLK4_NEMVE Serine/threonine-protein kinase PLK4 OS=Nematostella vectensis GN=v1g246408 PE=3 SV=1 850 1138 5.0E-14
sp|P34117|CDK5_DICDI Cyclin-dependent kinase 5 homolog OS=Dictyostelium discoideum GN=cdk5 PE=2 SV=2 846 1138 5.0E-14
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 847 1138 6.0E-14
sp|Q6AVM3|CCAMK_ORYSJ Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Oryza sativa subsp. japonica GN=CCAMK PE=2 SV=1 893 1137 7.0E-14
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 848 1139 7.0E-14
sp|Q75H77|SAPKA_ORYSJ Serine/threonine-protein kinase SAPK10 OS=Oryza sativa subsp. japonica GN=SAPK10 PE=2 SV=1 848 1138 7.0E-14
sp|O94737|MAPK1_PNECA Mitogen-activated protein kinase 1 OS=Pneumocystis carinii GN=MKP1 PE=1 SV=1 848 1138 7.0E-14
sp|O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans GN=unc-43 PE=1 SV=2 862 1138 7.0E-14
sp|P13234|KCC4_RAT Calcium/calmodulin-dependent protein kinase type IV OS=Rattus norvegicus GN=Camk4 PE=1 SV=3 886 1148 7.0E-14
sp|P24923|CDC21_MEDSA Cell division control protein 2 homolog 1 (Fragment) OS=Medicago sativa GN=CDC2A PE=2 SV=1 846 1138 8.0E-14
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 848 1138 8.0E-14
sp|P23572|CDK1_DROME Cyclin-dependent kinase 1 OS=Drosophila melanogaster GN=Cdk1 PE=1 SV=1 846 1138 9.0E-14
sp|A8WXF6|KCC2D_CAEBR Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis briggsae GN=unc-43 PE=3 SV=1 862 1138 9.0E-14
sp|Q84SN3|CDKF3_ORYSJ Cyclin-dependent kinase F-3 OS=Oryza sativa subsp. japonica GN=CDKF-3 PE=2 SV=1 847 1142 1.0E-13
sp|P08414|KCC4_MOUSE Calcium/calmodulin-dependent protein kinase type IV OS=Mus musculus GN=Camk4 PE=1 SV=2 886 1148 1.0E-13
sp|Q9QYZ6|SMK2A_MOUSE Sperm motility kinase 2A OS=Mus musculus GN=Smok2a PE=2 SV=1 851 1137 1.0E-13
sp|P13863|CDK1_CHICK Cyclin-dependent kinase 1 OS=Gallus gallus GN=CDK1 PE=1 SV=1 846 1138 1.0E-13
sp|Q9JLM8|DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus GN=Dclk1 PE=1 SV=1 879 1170 1.0E-13
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 846 1138 1.0E-13
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 887 1138 1.0E-13
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 846 1138 1.0E-13
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 846 1138 1.0E-13
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 846 1138 1.0E-13
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 846 1138 1.0E-13
sp|P43450|CDK2_CARAU Cyclin-dependent kinase 2 OS=Carassius auratus GN=cdk2 PE=2 SV=1 846 1138 1.0E-13
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 847 1138 1.0E-13
sp|P21708|MK03_RAT Mitogen-activated protein kinase 3 OS=Rattus norvegicus GN=Mapk3 PE=1 SV=5 945 1138 1.0E-13
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 846 1138 1.0E-13
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 848 1138 1.0E-13
sp|Q54I36|PYK3_DICDI Dual specificity protein kinase pyk3 OS=Dictyostelium discoideum GN=pyk3 PE=1 SV=1 841 1151 1.0E-13
sp|P27361|MK03_HUMAN Mitogen-activated protein kinase 3 OS=Homo sapiens GN=MAPK3 PE=1 SV=4 945 1138 1.0E-13
sp|Q63844|MK03_MOUSE Mitogen-activated protein kinase 3 OS=Mus musculus GN=Mapk3 PE=1 SV=5 945 1138 1.0E-13
sp|P93101|CDC2_OXYRB Cell division control protein 2 homolog OS=Oxybasis rubra GN=CDC2 PE=2 SV=1 846 1138 1.0E-13
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 847 1138 1.0E-13
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 846 1138 1.0E-13
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 846 1138 1.0E-13
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 889 1137 2.0E-13
sp|P04551|CDK1_SCHPO Cyclin-dependent kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc2 PE=1 SV=1 846 1138 2.0E-13
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 848 1140 2.0E-13
sp|Q03407|PKH1_YEAST Serine/threonine-protein kinase PKH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH1 PE=1 SV=1 830 1138 2.0E-13
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 846 1138 2.0E-13
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 841 1133 2.0E-13
sp|Q16566|KCC4_HUMAN Calcium/calmodulin-dependent protein kinase type IV OS=Homo sapiens GN=CAMK4 PE=1 SV=1 886 1148 2.0E-13
sp|Q60823|AKT2_MOUSE RAC-beta serine/threonine-protein kinase OS=Mus musculus GN=Akt2 PE=1 SV=1 848 1138 2.0E-13
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 848 1138 2.0E-13
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 846 1138 2.0E-13
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 846 1138 2.0E-13
sp|Q3SZW1|TSSK1_BOVIN Testis-specific serine/threonine-protein kinase 1 OS=Bos taurus GN=TSSK1B PE=2 SV=1 858 1146 2.0E-13
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 790 1143 2.0E-13
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 848 1138 2.0E-13
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 848 1138 2.0E-13
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 848 1138 2.0E-13
sp|A7J1T2|M313A_XENLA Mitogen-activated protein kinase kinase kinase 13-A OS=Xenopus laevis GN=map3k13-a PE=2 SV=1 841 1135 2.0E-13
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 846 1138 2.0E-13
sp|P54666|CC2H3_TRYBB Cell division control protein 2 homolog 3 OS=Trypanosoma brucei brucei GN=CRK3 PE=3 SV=1 843 1138 2.0E-13
sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens GN=CHEK2 PE=1 SV=1 841 1138 2.0E-13
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 846 1154 3.0E-13
sp|Q9UPZ9|ICK_HUMAN Serine/threonine-protein kinase ICK OS=Homo sapiens GN=ICK PE=1 SV=1 843 1138 3.0E-13
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 848 1138 3.0E-13
sp|G5EGQ3|MAX2_CAEEL Serine/threonine-protein kinase max-2 OS=Caenorhabditis elegans GN=max-2 PE=1 SV=1 823 1148 3.0E-13
sp|P29619|CDKA2_ORYSJ Cyclin-dependent kinase A-2 OS=Oryza sativa subsp. japonica GN=CDKA-2 PE=2 SV=1 846 1138 3.0E-13
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 886 1138 3.0E-13
sp|Q6Z8C8|CDKF4_ORYSJ Cyclin-dependent kinase F-4 OS=Oryza sativa subsp. japonica GN=CDKF-4 PE=2 SV=1 846 1138 3.0E-13
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 862 1145 3.0E-13
sp|Q91ZR4|NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus GN=Nek8 PE=1 SV=1 865 1137 3.0E-13
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 847 1152 3.0E-13
sp|P97377|CDK2_MOUSE Cyclin-dependent kinase 2 OS=Mus musculus GN=Cdk2 PE=1 SV=2 846 1126 4.0E-13
sp|P43063|CDK1_CANAL Cyclin-dependent kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC28 PE=1 SV=1 846 1138 4.0E-13
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 862 1145 4.0E-13
sp|Q9FKW4|CDPKS_ARATH Calcium-dependent protein kinase 28 OS=Arabidopsis thaliana GN=CPK28 PE=1 SV=1 783 1135 4.0E-13
sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 865 1137 4.0E-13
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 847 1138 4.0E-13
sp|D3ZGQ5|NEK8_RAT Serine/threonine-protein kinase Nek8 OS=Rattus norvegicus GN=Nek8 PE=1 SV=1 865 1137 4.0E-13
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 848 1137 4.0E-13
sp|Q02723|RKIN1_SECCE Carbon catabolite-derepressing protein kinase OS=Secale cereale GN=RKIN1 PE=2 SV=1 848 1138 4.0E-13
sp|Q9Y6E0|STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens GN=STK24 PE=1 SV=1 846 1157 4.0E-13
sp|D4AE59|STK11_RAT Serine/threonine-protein kinase STK11 OS=Rattus norvegicus GN=Stk11 PE=1 SV=1 880 1138 4.0E-13
sp|Q84TI6|CDKE1_ARATH Cyclin-dependent kinase E-1 OS=Arabidopsis thaliana GN=CDKE-1 PE=1 SV=2 841 1138 4.0E-13
sp|Q54U31|SHKD_DICDI Dual specificity protein kinase shkD OS=Dictyostelium discoideum GN=shkD PE=3 SV=1 841 1133 5.0E-13
sp|Q6PGN3|DCLK2_MOUSE Serine/threonine-protein kinase DCLK2 OS=Mus musculus GN=Dclk2 PE=1 SV=1 861 1137 5.0E-13
sp|Q6Z437|MPK3_ORYSJ Mitogen-activated protein kinase 3 OS=Oryza sativa subsp. japonica GN=MPK3 PE=2 SV=1 835 1140 5.0E-13
sp|P51955|NEK2_HUMAN Serine/threonine-protein kinase Nek2 OS=Homo sapiens GN=NEK2 PE=1 SV=1 868 1138 6.0E-13
sp|P47196|AKT1_RAT RAC-alpha serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt1 PE=1 SV=1 824 1138 6.0E-13
sp|P31751|AKT2_HUMAN RAC-beta serine/threonine-protein kinase OS=Homo sapiens GN=AKT2 PE=1 SV=2 848 1138 6.0E-13
sp|D2I3C6|DCLK2_AILME Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca GN=DCLK2 PE=3 SV=1 775 1137 6.0E-13
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 843 1138 6.0E-13
sp|Q05006|CDC22_MEDSA Cell division control protein 2 homolog 2 OS=Medicago sativa GN=CDC2B PE=2 SV=1 846 1138 6.0E-13
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 846 1138 7.0E-13
sp|Q99KH8|STK24_MOUSE Serine/threonine-protein kinase 24 OS=Mus musculus GN=Stk24 PE=1 SV=1 846 1157 7.0E-13
sp|Q07785|CDC2H_PLAFK Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CRK2 PE=1 SV=1 846 1138 7.0E-13
sp|P61075|CDC2H_PLAF7 Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate 3D7) GN=CRK2 PE=3 SV=1 846 1138 7.0E-13
sp|Q8SWM6|CDC5_ENCCU Probable cell cycle serine/threonine-protein kinase CDC5 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC5 PE=3 SV=2 810 1138 7.0E-13
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 892 1138 7.0E-13
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 846 1138 8.0E-13
sp|Q75V57|SAPK9_ORYSJ Serine/threonine-protein kinase SAPK9 OS=Oryza sativa subsp. japonica GN=SAPK9 PE=2 SV=1 893 1178 8.0E-13
sp|Q1HKZ5|M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus GN=Map3k13 PE=1 SV=1 841 1135 8.0E-13
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 847 1154 8.0E-13
sp|Q9JKV2|ICK_MOUSE Serine/threonine-protein kinase ICK OS=Mus musculus GN=Ick PE=1 SV=2 843 1138 9.0E-13
sp|Q93VK0|PPCK2_ARATH Phosphoenolpyruvate carboxylase kinase 2 OS=Arabidopsis thaliana GN=PPCK2 PE=1 SV=2 846 1135 9.0E-13
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 881 1129 9.0E-13
sp|B0LT89|STK24_RAT Serine/threonine-protein kinase 24 OS=Rattus norvegicus GN=Stk24 PE=2 SV=1 846 1157 1.0E-12
sp|Q5N942|SAPK4_ORYSJ Serine/threonine-protein kinase SAPK4 OS=Oryza sativa subsp. japonica GN=SAPK4 PE=2 SV=2 893 1138 1.0E-12
sp|O44514|PMK3_CAEEL Mitogen-activated protein kinase pmk-3 OS=Caenorhabditis elegans GN=pmk-3 PE=1 SV=2 827 1138 1.0E-12
sp|P52304|POLO_DROME Serine/threonine-protein kinase polo OS=Drosophila melanogaster GN=polo PE=1 SV=2 857 1138 1.0E-12
sp|Q9WTR2|M3K6_MOUSE Mitogen-activated protein kinase kinase kinase 6 OS=Mus musculus GN=Map3k6 PE=1 SV=4 848 1143 1.0E-12
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 848 1138 1.0E-12
sp|Q62726|ICK_RAT Serine/threonine-protein kinase ICK OS=Rattus norvegicus GN=Ick PE=1 SV=1 843 1138 1.0E-12
sp|G5EFU0|PK2_CAEEL Serine/threonine-protein kinase pak-2 OS=Caenorhabditis elegans GN=pak-2 PE=2 SV=1 846 1138 1.0E-12
sp|Q54CY9|MYLKD_DICDI Probable myosin light chain kinase DDB_G0292624 OS=Dictyostelium discoideum GN=DDB_G0292624 PE=3 SV=1 880 1137 1.0E-12
sp|O43283|M3K13_HUMAN Mitogen-activated protein kinase kinase kinase 13 OS=Homo sapiens GN=MAP3K13 PE=1 SV=1 841 1135 1.0E-12
sp|Q41639|CDC2_VIGAC Cell division control protein 2 homolog OS=Vigna aconitifolia GN=CDC2 PE=2 SV=1 846 1138 1.0E-12
sp|Q5R8X7|M3K13_PONAB Mitogen-activated protein kinase kinase kinase 13 OS=Pongo abelii GN=MAP3K13 PE=2 SV=1 841 1135 1.0E-12
sp|Q9UBS0|KS6B2_HUMAN Ribosomal protein S6 kinase beta-2 OS=Homo sapiens GN=RPS6KB2 PE=1 SV=2 881 1138 1.0E-12
sp|A1D624|SSN3_NEOFI Serine/threonine-protein kinase ssn3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ssn3 PE=3 SV=1 851 1138 1.0E-12
sp|Q61241|TSSK1_MOUSE Testis-specific serine/threonine-protein kinase 1 OS=Mus musculus GN=Tssk1b PE=1 SV=2 858 1146 1.0E-12
sp|Q9NGW9|MKCB_DICDI Probable serine/threonine-protein kinase mkcB OS=Dictyostelium discoideum GN=mkcB PE=2 SV=1 809 1138 1.0E-12
sp|Q6C4M9|HOG1_YARLI Mitogen-activated protein kinase HOG1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HOG1 PE=3 SV=1 945 1140 1.0E-12
sp|Q4WYR6|SSN3_ASPFU Serine/threonine-protein kinase ssn3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ssn3 PE=3 SV=2 851 1138 2.0E-12
sp|B1H3E1|NLK2_XENTR Serine/threonine-protein kinase NLK2 OS=Xenopus tropicalis GN=nlk.2 PE=2 SV=1 863 1138 2.0E-12
sp|Q8I7M8|CDK17_CAEEL Cyclin-dependent kinase 17 OS=Caenorhabditis elegans GN=pct-1 PE=1 SV=1 775 1138 2.0E-12
sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 889 1137 2.0E-12
sp|Q54MY9|MKCA_DICDI Probable serine/threonine-protein kinase mkcA OS=Dictyostelium discoideum GN=mkcA PE=2 SV=1 882 1138 2.0E-12
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 789 1138 2.0E-12
sp|Q09831|PPK14_SCHPO Serine/threonine-protein kinase ppk14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk14 PE=1 SV=1 731 1138 2.0E-12
sp|O43293|DAPK3_HUMAN Death-associated protein kinase 3 OS=Homo sapiens GN=DAPK3 PE=1 SV=1 882 1144 2.0E-12
sp|Q9LET1|CAMK7_ARATH CDPK-related kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=1 SV=1 860 1138 2.0E-12
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 847 1143 2.0E-12
sp|Q54JG7|DST4_DICDI Serine/threonine-protein kinase dst4 OS=Dictyostelium discoideum GN=dst4 PE=3 SV=1 846 1143 2.0E-12
sp|Q8K3H5|MYO3A_MOUSE Myosin-IIIa OS=Mus musculus GN=Myo3a PE=2 SV=1 846 1050 2.0E-12
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 873 1144 2.0E-12
sp|Q9FX86|CAMK8_ARATH CDPK-related kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=1 842 1137 2.0E-12
sp|Q8QGV6|NLK2_XENLA Serine/threonine-protein kinase NLK2 OS=Xenopus laevis GN=nlk.2 PE=1 SV=1 863 1138 2.0E-12
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 846 1138 3.0E-12
sp|Q9GT24|ZYG1_CAEEL Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis elegans GN=zyg-1 PE=1 SV=1 846 1139 3.0E-12
sp|O54784|DAPK3_MOUSE Death-associated protein kinase 3 OS=Mus musculus GN=Dapk3 PE=1 SV=1 882 1144 3.0E-12
sp|O88764|DAPK3_RAT Death-associated protein kinase 3 OS=Rattus norvegicus GN=Dapk3 PE=1 SV=1 882 1144 3.0E-12
sp|Q80Y86|MK15_MOUSE Mitogen-activated protein kinase 15 OS=Mus musculus GN=Mapk15 PE=1 SV=1 844 1146 3.0E-12
sp|Q00534|CDK6_HUMAN Cyclin-dependent kinase 6 OS=Homo sapiens GN=CDK6 PE=1 SV=1 847 1138 3.0E-12
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 892 1138 3.0E-12
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 848 1138 3.0E-12
sp|O94537|PPK4_SCHPO Serine/threonine-protein kinase ppk4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk4 PE=3 SV=1 182 644 4.0E-12
sp|Q9WTK7|STK11_MOUSE Serine/threonine-protein kinase STK11 OS=Mus musculus GN=Stk11 PE=1 SV=1 880 1138 4.0E-12
sp|P23293|BUR1_YEAST Serine/threonine-protein kinase BUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGV1 PE=1 SV=1 845 1138 4.0E-12
sp|P54119|CDK1_AJECA Cyclin-dependent kinase 1 OS=Ajellomyces capsulatus GN=CDC2 PE=3 SV=1 846 1138 4.0E-12
sp|Q6YY75|NEK6_ORYSJ Serine/threonine-protein kinase Nek6 OS=Oryza sativa subsp. japonica GN=NEK6 PE=3 SV=2 846 1140 4.0E-12
sp|P54665|CC2H2_TRYBB Cell division control protein 2 homolog 2 OS=Trypanosoma brucei brucei GN=CRK2 PE=3 SV=1 846 1138 4.0E-12
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 869 1138 4.0E-12
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 848 1137 4.0E-12
sp|Q00772|SLT2_YEAST Mitogen-activated protein kinase SLT2/MPK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLT2 PE=1 SV=2 846 1138 4.0E-12
sp|O96821|CDC2H_PLAKH Cell division control protein 2 homolog OS=Plasmodium knowlesi (strain H) GN=CRK2 PE=3 SV=1 846 1138 4.0E-12
sp|Q9ZSA3|CDPKM_ARATH Calcium-dependent protein kinase 22 OS=Arabidopsis thaliana GN=CPK22 PE=3 SV=2 883 1138 5.0E-12
sp|Q38773|CDC2B_ANTMA Cell division control protein 2 homolog B (Fragment) OS=Antirrhinum majus GN=CDC2B PE=2 SV=1 880 1138 5.0E-12
sp|P24100|CDKA1_ARATH Cyclin-dependent kinase A-1 OS=Arabidopsis thaliana GN=CDKA-1 PE=1 SV=1 846 1138 5.0E-12
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 848 1137 5.0E-12
sp|Q39016|CDPKB_ARATH Calcium-dependent protein kinase 11 OS=Arabidopsis thaliana GN=CPK11 PE=1 SV=2 870 1138 5.0E-12
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 882 1142 6.0E-12
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 882 1142 6.0E-12
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 846 1157 6.0E-12
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 847 1138 6.0E-12
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 846 1157 6.0E-12
sp|P97756|KKCC1_RAT Calcium/calmodulin-dependent protein kinase kinase 1 OS=Rattus norvegicus GN=Camkk1 PE=1 SV=1 917 1137 6.0E-12
sp|Q0GGW5|STK11_CHICK Serine/threonine-protein kinase STK11 OS=Gallus gallus GN=STK11 PE=2 SV=1 880 1138 6.0E-12
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 832 1141 7.0E-12
sp|P63086|MK01_RAT Mitogen-activated protein kinase 1 OS=Rattus norvegicus GN=Mapk1 PE=1 SV=3 945 1170 7.0E-12
sp|P63085|MK01_MOUSE Mitogen-activated protein kinase 1 OS=Mus musculus GN=Mapk1 PE=1 SV=3 945 1170 7.0E-12
sp|P28482|MK01_HUMAN Mitogen-activated protein kinase 1 OS=Homo sapiens GN=MAPK1 PE=1 SV=3 945 1170 7.0E-12
sp|Q6P431|MKNK2_XENLA MAP kinase-interacting serine/threonine-protein kinase 2 OS=Xenopus laevis GN=mknk2 PE=2 SV=1 882 1137 7.0E-12
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 875 1142 7.0E-12
sp|Q2PQN9|CDK5_GLOMM Cyclin-dependent kinase 5 homolog OS=Glossina morsitans morsitans GN=Cdk5 PE=2 SV=1 846 1138 7.0E-12
sp|Q8RXG3|M2K5_ARATH Mitogen-activated protein kinase kinase 5 OS=Arabidopsis thaliana GN=MKK5 PE=1 SV=2 841 1138 8.0E-12
sp|P42525|ERK1_DICDI Extracellular signal-regulated kinase 1 OS=Dictyostelium discoideum GN=erkA PE=2 SV=2 848 1138 8.0E-12
sp|A7MBB4|M3K13_BOVIN Mitogen-activated protein kinase kinase kinase 13 OS=Bos taurus GN=MAP3K13 PE=2 SV=1 841 1135 8.0E-12
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 848 1138 8.0E-12
sp|Q9Y1J3|PDPK1_CAEEL 3-phosphoinositide-dependent protein kinase 1 OS=Caenorhabditis elegans GN=pdk-1 PE=1 SV=1 792 1138 9.0E-12
sp|Q54XL6|FRAY1_DICDI Serine/threonine-protein kinase fray1 OS=Dictyostelium discoideum GN=fray1 PE=3 SV=1 841 1143 9.0E-12
sp|E2QWQ2|NLK_CANLF Serine/threonine-protein kinase NLK OS=Canis lupus familiaris GN=NLK PE=3 SV=1 863 1138 9.0E-12
sp|Q66JT0|WEE2_MOUSE Wee1-like protein kinase 2 OS=Mus musculus GN=Wee2 PE=1 SV=2 846 1140 9.0E-12
sp|P70032|PLK1_XENLA Serine/threonine-protein kinase PLK1 OS=Xenopus laevis GN=plk1 PE=1 SV=1 857 1138 1.0E-11
sp|Q13188|STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens GN=STK3 PE=1 SV=2 846 1138 1.0E-11
sp|D3ZSZ3|NLK_RAT Serine/threonine-protein kinase NLK OS=Rattus norvegicus GN=Nlk PE=3 SV=1 863 1138 1.0E-11
sp|O54949|NLK_MOUSE Serine/threonine-protein kinase NLK OS=Mus musculus GN=Nlk PE=1 SV=2 863 1138 1.0E-11
sp|Q9UBE8|NLK_HUMAN Serine/threonine-protein kinase NLK OS=Homo sapiens GN=NLK PE=1 SV=2 863 1138 1.0E-11
sp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1 OS=Oryza sativa subsp. japonica GN=CAMK1 PE=1 SV=1 860 1138 1.0E-11
sp|Q8N568|DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens GN=DCLK2 PE=2 SV=4 861 1137 1.0E-11
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 827 1025 1.0E-11
sp|Q64261|CDK6_MOUSE Cyclin-dependent kinase 6 OS=Mus musculus GN=Cdk6 PE=1 SV=2 847 1138 1.0E-11
sp|Q23915|KINX_DICDI Probable serine/threonine-protein kinase kinX OS=Dictyostelium discoideum GN=kinX PE=3 SV=2 850 1132 1.0E-11
sp|Q5KQF5|CIPKM_ORYSJ CBL-interacting protein kinase 22 OS=Oryza sativa subsp. japonica GN=CIPK22 PE=2 SV=1 882 1138 1.0E-11
sp|O42626|NRC2_NEUCR Serine/threonine-protein kinase nrc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nrc-2 PE=3 SV=1 835 1138 1.0E-11
sp|P26696|MK01_XENLA Mitogen-activated protein kinase 1 OS=Xenopus laevis GN=mapk1 PE=1 SV=3 945 1170 1.0E-11
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 893 1147 1.0E-11
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 838 1138 1.0E-11
sp|P43294|MHK_ARATH Serine/threonine-protein kinase MHK OS=Arabidopsis thaliana GN=MHK PE=2 SV=2 846 1138 1.0E-11
sp|E1BMN8|NLK_BOVIN Serine/threonine-protein kinase NLK OS=Bos taurus GN=NLK PE=3 SV=2 863 1138 1.0E-11
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 846 1145 1.0E-11
sp|Q8IZL9|CDK20_HUMAN Cyclin-dependent kinase 20 OS=Homo sapiens GN=CDK20 PE=1 SV=1 847 1139 1.0E-11
sp|P46196|MK01_BOVIN Mitogen-activated protein kinase 1 OS=Bos taurus GN=MAPK1 PE=2 SV=3 941 1138 1.0E-11
sp|Q9Z2A6|MK15_RAT Mitogen-activated protein kinase 15 OS=Rattus norvegicus GN=Mapk15 PE=1 SV=2 844 1146 1.0E-11
sp|Q9ZSA4|CDPKR_ARATH Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 833 1138 1.0E-11
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 846 1156 1.0E-11
sp|P52389|CDC2_VIGUN Cell division control protein 2 homolog OS=Vigna unguiculata GN=CDC2 PE=2 SV=1 846 1138 1.0E-11
sp|O96013|PAK4_HUMAN Serine/threonine-protein kinase PAK 4 OS=Homo sapiens GN=PAK4 PE=1 SV=1 847 1138 1.0E-11
sp|Q55FJ6|Y8078_DICDI Probable serine/threonine-protein kinase DDB_G0268078 OS=Dictyostelium discoideum GN=DDB_G0268078 PE=3 SV=1 846 1138 2.0E-11
sp|Q75KK8|MPK14_ORYSJ Mitogen-activated protein kinase 14 OS=Oryza sativa subsp. japonica GN=MPK14 PE=2 SV=1 846 1237 2.0E-11
sp|O14328|KSP1_SCHPO Serine/threonine-protein kinase ksp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksp1 PE=1 SV=1 848 1130 2.0E-11
sp|Q54EY4|DST3_DICDI Serine/threonine-protein kinase dst3 OS=Dictyostelium discoideum GN=dst3 PE=3 SV=1 846 1138 2.0E-11
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 848 1143 2.0E-11
sp|Q9N2L7|PLK2_CAEEL Serine/threonine-protein kinase plk-2 OS=Caenorhabditis elegans GN=plk-2 PE=2 SV=1 852 1138 2.0E-11
sp|O94804|STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens GN=STK10 PE=1 SV=1 892 1137 2.0E-11
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 846 1151 2.0E-11
sp|Q5AHG6|SCH9_CANAL Serine/threonine-protein kinase SCH9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SCH9 PE=3 SV=1 951 1138 2.0E-11
sp|O45818|DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans GN=dkf-2 PE=1 SV=4 841 1080 2.0E-11
sp|Q5F3W3|MK06_CHICK Mitogen-activated protein kinase 6 OS=Gallus gallus GN=MAPK6 PE=2 SV=1 848 1138 2.0E-11
sp|P0C1S8|WEE2_HUMAN Wee1-like protein kinase 2 OS=Homo sapiens GN=WEE2 PE=2 SV=2 846 1140 2.0E-11
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 846 1138 2.0E-11
sp|Q8R4V0|SGK3_RAT Serine/threonine-protein kinase Sgk3 OS=Rattus norvegicus GN=Sgk3 PE=1 SV=2 848 1138 2.0E-11
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 829 1138 2.0E-11
sp|Q8VBY2|KKCC1_MOUSE Calcium/calmodulin-dependent protein kinase kinase 1 OS=Mus musculus GN=Camkk1 PE=1 SV=1 917 1138 2.0E-11
sp|Q6L5F7|MPK17_ORYSJ Mitogen-activated protein kinase 17 OS=Oryza sativa subsp. japonica GN=MPK17 PE=2 SV=2 843 1197 2.0E-11
sp|Q9U1Y5|CHK2_CAEEL Serine/threonine-protein kinase chk-2 OS=Caenorhabditis elegans GN=chk-2 PE=2 SV=2 844 1134 2.0E-11
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 893 1147 2.0E-11
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Stk3 PE=1 SV=1 846 1138 2.0E-11
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=3 SV=1 846 1151 3.0E-11
sp|Q9WVS8|MK07_MOUSE Mitogen-activated protein kinase 7 OS=Mus musculus GN=Mapk7 PE=1 SV=1 841 1138 3.0E-11
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 859 1138 3.0E-11
sp|O35942|NEK2_MOUSE Serine/threonine-protein kinase Nek2 OS=Mus musculus GN=Nek2 PE=1 SV=2 883 1138 3.0E-11
sp|Q9P286|PAK7_HUMAN Serine/threonine-protein kinase PAK 7 OS=Homo sapiens GN=PAK7 PE=1 SV=1 847 1138 3.0E-11
sp|P0C865|MK07_RAT Mitogen-activated protein kinase 7 OS=Rattus norvegicus GN=Mapk7 PE=1 SV=1 841 1138 3.0E-11
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 822 987 3.0E-11
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 893 1138 3.0E-11
sp|Q5MPA9|DCLK2_RAT Serine/threonine-protein kinase DCLK2 OS=Rattus norvegicus GN=Dclk2 PE=1 SV=2 861 1137 3.0E-11
sp|O14408|KCC1_METAN Calcium/calmodulin-dependent protein kinase OS=Metarhizium anisopliae PE=2 SV=1 848 1135 3.0E-11
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 846 1151 3.0E-11
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 848 1157 3.0E-11
sp|Q7ZUQ3|STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio GN=stk3 PE=2 SV=1 846 1138 3.0E-11
sp|P51139|MSK3_MEDSA Glycogen synthase kinase-3 homolog MsK-3 OS=Medicago sativa GN=MSK-3 PE=2 SV=2 792 1170 3.0E-11
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 846 1151 3.0E-11
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 846 1151 3.0E-11
sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens GN=ULK1 PE=1 SV=2 837 1025 3.0E-11
sp|P50530|SCK1_SCHPO Serine/threonine-protein kinase sck1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sck1 PE=1 SV=2 947 1138 4.0E-11
sp|Q54BF0|FHKA_DICDI Probable serine/threonine-protein kinase fhkA OS=Dictyostelium discoideum GN=fhkA PE=3 SV=1 846 1138 4.0E-11
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 864 1138 4.0E-11
sp|O64812|SRK2J_ARATH Serine/threonine-protein kinase SRK2J OS=Arabidopsis thaliana GN=SRK2J PE=1 SV=1 848 1138 4.0E-11
sp|Q8CDB0|MKNK2_MOUSE MAP kinase-interacting serine/threonine-protein kinase 2 OS=Mus musculus GN=Mknk2 PE=1 SV=3 865 1137 4.0E-11
sp|Q8BTW9|PAK4_MOUSE Serine/threonine-protein kinase PAK 4 OS=Mus musculus GN=Pak4 PE=1 SV=1 847 1138 4.0E-11
sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus GN=Stk3 PE=1 SV=1 846 1138 4.0E-11
sp|Q66I46|MKNK2_XENTR MAP kinase-interacting serine/threonine-protein kinase 2 OS=Xenopus tropicalis GN=mknk2 PE=2 SV=1 882 1137 4.0E-11
sp|P9WI67|PKNJ_MYCTU Serine/threonine-protein kinase PknJ OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknJ PE=1 SV=1 847 1079 4.0E-11
sp|P9WI66|PKNJ_MYCTO Serine/threonine-protein kinase PknJ OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknJ PE=1 SV=1 847 1079 4.0E-11
sp|P65733|PKNJ_MYCBO Serine/threonine-protein kinase PknJ OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknJ PE=3 SV=1 847 1079 4.0E-11
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 846 1137 4.0E-11
sp|A8WRV1|KIN29_CAEBR Serine/threonine-protein kinase kin-29 OS=Caenorhabditis briggsae GN=kin-29 PE=3 SV=2 829 1135 4.0E-11
sp|P34112|CDK1_DICDI Cyclin-dependent kinase 1 OS=Dictyostelium discoideum GN=cdk1 PE=2 SV=1 846 1138 4.0E-11
sp|Q5U2N4|MKNK2_RAT MAP kinase-interacting serine/threonine-protein kinase 2 OS=Rattus norvegicus GN=Mknk2 PE=2 SV=1 865 1137 4.0E-11
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 835 1138 4.0E-11
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 847 1138 4.0E-11
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 846 1145 5.0E-11
sp|Q6BRY2|PHO85_DEBHA Negative regulator of the PHO system OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PHO85 PE=3 SV=2 846 1138 5.0E-11
sp|Q00646|CDK1_EMENI Cyclin-dependent kinase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimX PE=2 SV=1 846 1138 5.0E-11
sp|Q8C078|KKCC2_MOUSE Calcium/calmodulin-dependent protein kinase kinase 2 OS=Mus musculus GN=Camkk2 PE=1 SV=2 882 1138 5.0E-11
sp|P23573|CDK2_DROME Cyclin-dependent kinase 2 OS=Drosophila melanogaster GN=Cdk2 PE=1 SV=1 846 1138 5.0E-11
sp|E9Q3S4|M3K19_MOUSE Mitogen-activated protein kinase kinase kinase 19 OS=Mus musculus GN=Map3k19 PE=3 SV=1 846 1138 5.0E-11
sp|O34507|PRKC_BACSU Serine/threonine-protein kinase PrkC OS=Bacillus subtilis (strain 168) GN=prkC PE=1 SV=1 865 1080 5.0E-11
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 847 1138 5.0E-11
sp|P51136|GSK3_DICDI Glycogen synthase kinase-3 OS=Dictyostelium discoideum GN=gskA PE=1 SV=2 834 1138 5.0E-11
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 842 1138 5.0E-11
sp|D4A280|PAK7_RAT Serine/threonine-protein kinase PAK 7 OS=Rattus norvegicus GN=Pak7 PE=1 SV=1 847 1138 5.0E-11
sp|Q8N5S9|KKCC1_HUMAN Calcium/calmodulin-dependent protein kinase kinase 1 OS=Homo sapiens GN=CAMKK1 PE=1 SV=2 945 1137 6.0E-11
sp|Q13164|MK07_HUMAN Mitogen-activated protein kinase 7 OS=Homo sapiens GN=MAPK7 PE=1 SV=2 841 1138 6.0E-11
sp|P00546|CDK1_YEAST Cyclin-dependent kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC28 PE=1 SV=1 865 1138 6.0E-11
sp|Q8C015|PAK7_MOUSE Serine/threonine-protein kinase PAK 7 OS=Mus musculus GN=Pak7 PE=1 SV=1 847 1138 6.0E-11
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 817 1160 6.0E-11
sp|Q53N72|MPK15_ORYSJ Mitogen-activated protein kinase 15 OS=Oryza sativa subsp. japonica GN=MPK15 PE=2 SV=1 846 1237 6.0E-11
sp|Q8NEV4|MYO3A_HUMAN Myosin-IIIa OS=Homo sapiens GN=MYO3A PE=2 SV=2 846 1050 6.0E-11
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 835 1138 6.0E-11
sp|O88831|KKCC2_RAT Calcium/calmodulin-dependent protein kinase kinase 2 OS=Rattus norvegicus GN=Camkk2 PE=1 SV=1 882 1138 6.0E-11
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 849 1138 7.0E-11
sp|Q02066|AAIP_WHEAT Abscisic acid-inducible protein kinase (Fragment) OS=Triticum aestivum PE=2 SV=1 890 1169 7.0E-11
sp|Q9Y7W4|BUR1_CANAL Serine/threonine-protein kinase BUR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRK1 PE=3 SV=2 805 1138 7.0E-11
sp|Q621J7|ZYG1_CAEBR Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis briggsae GN=zyg-1 PE=3 SV=1 846 1133 7.0E-11
sp|Q924U5|TESK2_RAT Dual specificity testis-specific protein kinase 2 OS=Rattus norvegicus GN=Tesk2 PE=2 SV=1 824 1132 7.0E-11
sp|Q8W4J2|MPK16_ARATH Mitogen-activated protein kinase 16 OS=Arabidopsis thaliana GN=MPK16 PE=2 SV=2 846 1181 7.0E-11
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 846 1151 8.0E-11
sp|A5PKJ4|MK07_BOVIN Mitogen-activated protein kinase 7 OS=Bos taurus GN=MAPK7 PE=2 SV=1 841 1138 8.0E-11
sp|Q6C3D7|STE20_YARLI Serine/threonine-protein kinase STE20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STE20 PE=3 SV=1 847 1019 8.0E-11
sp|A8XQD5|DKF2_CAEBR Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis briggsae GN=dkf-2 PE=3 SV=2 841 1135 8.0E-11
sp|Q54RV3|PAKG_DICDI Serine/threonine-protein kinase pakG OS=Dictyostelium discoideum GN=pakG PE=3 SV=1 848 1138 9.0E-11
sp|P21965|MCK1_YEAST Protein kinase MCK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCK1 PE=1 SV=1 878 1138 9.0E-11
sp|Q6CJA8|HOG1_KLULA Mitogen-activated protein kinase HOG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HOG1 PE=3 SV=1 830 1140 9.0E-11
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 846 1151 9.0E-11
sp|O55098|STK10_MOUSE Serine/threonine-protein kinase 10 OS=Mus musculus GN=Stk10 PE=1 SV=2 892 1137 9.0E-11
sp|O14427|CLA4_CANAX Serine/threonine-protein kinase CLA4 OS=Candida albicans GN=CLA4 PE=3 SV=1 846 1019 9.0E-11
sp|Q5APR8|CLA4_CANAL Serine/threonine-protein kinase CLA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLA4 PE=1 SV=1 846 1019 9.0E-11
sp|O04160|KSGT_BRANA Shaggy-related protein kinase theta OS=Brassica napus PE=2 SV=2 848 1138 1.0E-10
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 849 1138 1.0E-10
sp|Q56UN5|M3K19_HUMAN Mitogen-activated protein kinase kinase kinase 19 OS=Homo sapiens GN=MAP3K19 PE=2 SV=1 846 1138 1.0E-10
sp|Q06060|MPK_PEA Mitogen-activated protein kinase homolog D5 OS=Pisum sativum PE=2 SV=1 848 1153 1.0E-10
sp|Q9HBY8|SGK2_HUMAN Serine/threonine-protein kinase Sgk2 OS=Homo sapiens GN=SGK2 PE=1 SV=1 947 1140 1.0E-10
sp|Q0WPH8|NEK5_ARATH Serine/threonine-protein kinase Nek5 OS=Arabidopsis thaliana GN=NEK5 PE=1 SV=1 836 1140 1.0E-10
sp|Q4G050|MKNK1_RAT MAP kinase-interacting serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mknk1 PE=2 SV=1 844 1137 1.0E-10
sp|Q96RR4|KKCC2_HUMAN Calcium/calmodulin-dependent protein kinase kinase 2 OS=Homo sapiens GN=CAMKK2 PE=1 SV=2 882 1137 1.0E-10
sp|Q55GC2|DST2_DICDI Serine/threonine-protein kinase dst2 OS=Dictyostelium discoideum GN=dst2 PE=3 SV=1 846 1157 1.0E-10
sp|Q9XZD6|CDC2H_PLAVI Cell division control protein 2 homolog OS=Plasmodium vivax GN=CRK2 PE=3 SV=1 846 1138 1.0E-10
sp|Q336M2|CDKE1_ORYSJ Cyclin-dependent kinase E-1 OS=Oryza sativa subsp. japonica GN=CDKE-1 PE=2 SV=2 880 1138 1.0E-10
sp|Q55C57|GLKA_DICDI Probable serine/threonine-protein kinase glkA OS=Dictyostelium discoideum GN=glkA PE=3 SV=1 846 1138 1.0E-10
sp|Q94CU5|NEK5_ORYSJ Serine/threonine-protein kinase Nek5 OS=Oryza sativa subsp. japonica GN=NEK5 PE=3 SV=1 836 1140 1.0E-10
sp|Q6CRA9|BUR1_KLULA Serine/threonine-protein kinase BUR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=BUR1 PE=3 SV=1 846 1068 1.0E-10
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 846 1151 1.0E-10
sp|Q17446|PMK1_CAEEL Mitogen-activated protein kinase pmk-1 OS=Caenorhabditis elegans GN=pmk-1 PE=1 SV=1 848 1138 1.0E-10
sp|Q8RXT4|NEK4_ARATH Serine/threonine-protein kinase Nek4 OS=Arabidopsis thaliana GN=NEK4 PE=2 SV=1 846 1140 1.0E-10
sp|Q4KTY1|KPSH1_PINFU Serine/threonine-protein kinase H1 homolog OS=Pinctada fucata GN=PSKH1 PE=2 SV=1 874 1138 1.0E-10
sp|Q9ESG9|PMYT1_MOUSE Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Mus musculus GN=Pkmyt1 PE=2 SV=3 847 1142 1.0E-10
sp|Q6DD27|TAOK3_XENLA Serine/threonine-protein kinase TAO3 OS=Xenopus laevis GN=taok3 PE=2 SV=1 847 1139 1.0E-10
sp|E9PTG8|STK10_RAT Serine/threonine-protein kinase 10 OS=Rattus norvegicus GN=Stk10 PE=1 SV=1 892 1138 1.0E-10
sp|Q6FQ83|BUR1_CANGA Serine/threonine-protein kinase BUR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=BUR1 PE=3 SV=1 846 1152 1.0E-10
sp|Q54F40|Y1133_DICDI Probable protein kinase DDB_G0291133 OS=Dictyostelium discoideum GN=DDB_G0291133 PE=3 SV=1 847 1078 1.0E-10
sp|Q9ERE3|SGK3_MOUSE Serine/threonine-protein kinase Sgk3 OS=Mus musculus GN=Sgk3 PE=1 SV=1 848 1138 1.0E-10
sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 846 1135 1.0E-10
sp|Q9BXA7|TSSK1_HUMAN Testis-specific serine/threonine-protein kinase 1 OS=Homo sapiens GN=TSSK1B PE=1 SV=1 858 1140 1.0E-10
sp|Q99640|PMYT1_HUMAN Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Homo sapiens GN=PKMYT1 PE=1 SV=1 847 1157 1.0E-10
sp|Q5R7I7|CDK20_PONAB Cyclin-dependent kinase 20 OS=Pongo abelii GN=CDK20 PE=2 SV=1 847 1139 1.0E-10
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 865 1126 1.0E-10
sp|Q03114|CDK5_RAT Cyclin-dependent-like kinase 5 OS=Rattus norvegicus GN=Cdk5 PE=1 SV=1 846 1138 1.0E-10
sp|Q21017|KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans GN=kin-29 PE=1 SV=2 846 1135 1.0E-10
sp|P36005|KDX1_YEAST Serine/threonine-protein kinase KDX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KDX1 PE=1 SV=1 864 1158 1.0E-10
sp|P51166|CDK5_XENLA Cyclin-dependent-like kinase 5 OS=Xenopus laevis GN=cdk5 PE=2 SV=1 846 1138 1.0E-10
sp|Q6ZEZ5|NEK3_ORYSJ Serine/threonine-protein kinase Nek3 OS=Oryza sativa subsp. japonica GN=NEK3 PE=2 SV=1 846 1140 1.0E-10
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 799 1141 1.0E-10
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 862 1133 1.0E-10
sp|A1CAF0|MPKC_ASPCL Mitogen-activated protein kinase mpkC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mpkC PE=3 SV=1 848 1140 1.0E-10
sp|Q7Y0B9|SAPK8_ORYSJ Serine/threonine-protein kinase SAPK8 OS=Oryza sativa subsp. japonica GN=SAPK8 PE=2 SV=1 893 1138 1.0E-10
sp|Q8QGV2|WEE1B_XENLA Wee1-like protein kinase 1-B OS=Xenopus laevis GN=wee1-b PE=1 SV=1 841 1135 2.0E-10
sp|P51137|MSK1_MEDSA Glycogen synthase kinase-3 homolog MsK-1 OS=Medicago sativa GN=MSK-1 PE=2 SV=1 848 1138 2.0E-10
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 862 1133 2.0E-10
sp|Q8VCT9|TESK2_MOUSE Dual specificity testis-specific protein kinase 2 OS=Mus musculus GN=Tesk2 PE=1 SV=1 824 1132 2.0E-10
sp|Q60DG4|NEK4_ORYSJ Serine/threonine-protein kinase Nek4 OS=Oryza sativa subsp. japonica GN=NEK4 PE=2 SV=1 836 1140 2.0E-10
sp|Q9U9Y8|NLK_CAEEL Serine/threonine kinase NLK OS=Caenorhabditis elegans GN=lit-1 PE=1 SV=1 864 1152 2.0E-10
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 846 1151 2.0E-10
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 830 1138 2.0E-10
sp|Q6P9R2|OXSR1_MOUSE Serine/threonine-protein kinase OSR1 OS=Mus musculus GN=Oxsr1 PE=1 SV=1 850 1144 2.0E-10
sp|Q9LMM5|MPK11_ARATH Mitogen-activated protein kinase 11 OS=Arabidopsis thaliana GN=MPK11 PE=1 SV=1 848 1140 2.0E-10
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 841 1030 1.0E-08
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 820 1138 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006397 mRNA processing Yes
GO:0006468 protein phosphorylation Yes
GO:0004540 ribonuclease activity Yes
GO:0004672 protein kinase activity Yes
GO:0005524 ATP binding Yes
GO:0043412 macromolecule modification No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0016070 RNA metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0044267 cellular protein metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0046483 heterocycle metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0017076 purine nucleotide binding No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0140098 catalytic activity, acting on RNA No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0009987 cellular process No
GO:0016071 mRNA metabolic process No
GO:1901363 heterocyclic compound binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:0006396 RNA processing No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0016787 hydrolase activity No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0004518 nuclease activity No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7658
MLRRPPVEARGLSQQQKLWLALAVFLIPWLQLADAQQQPQPRQQQQDHHHRHHHEQQQQHPHAIAHPVVAGPGDH
GGSQLSGQSAVARDWPAARLDTPDTPPDAALADAALADAALADADGSKKRPPAASPHDPPAGRATGQQPRRQPAD
GGRRQTPTDLINNKKQRIIPDDASALATLAPAQSVRAPHPPRHHRPSSVPASGLASPQLARSLEDWEVEDFVLLA
TVDGDLYAADRKTGKQRWHLEVDQPMVETIHHRANHSVLDDDYSPVDHYIWAVEPNRDGGVYVWVPSPDARPRAT
GFTMKRLVEELAPYAGEEPSVVYTGDKKTTMITLDAATGRVVKWFGSTGSHVNEAESCLRPNALYDKDAAECSST
GTITLGRTEYTVGIQRRDGRPIATLKYAEWSPNNYDNDLFQQYHVSLDSRYITSQHDGNIYSFDYARTGSAAPIF
SHKFAAPVVRVFDVCRPWQAAAETSLELVVLPQPAMPSQDESVARMRSNSVFLNQTEGGSWYALSGRQYPLIIEA
PLAQVSYPGWWDLASAWDDLTEASISKALVGTHSLDKIRHDSPQPPTLPQGTITDGNEDLDNDSNLPVLPEGEPD
EPTIINKVKGLPQSAANSVVDFIRNPILFLLFFAALVYNEKKLRKSYHRWRSHGNLRDTLAYLTSDASADKDGRQ
LPQADSTDDEDANRQQPANDEESRDRSKNDVGGQPNSAQPAEVLPQGEEAERHTLPEAQPEHGAGESRDEAGSPN
GAAESSSPGTAPEKKKKAHRGRRGGVKHRKGRAREQSQSRGDDEAAPTTVEEAVNNAKKLGDRPSLEPDVMTVAN
DMQAVTGPIIRMGNIEVNTNEQLGIGSNGTLVFAGRFDGREVAVKRMLIQFYDIASQETRLLRESDDHPNVIRYY
SQQIHDGFLYIALERCVASLAEVVDRPQDFRQIAEAGSTDVPGVLYQITNGISHLHSLRIVHRDLKPQNILVNMG
KDGKPRLLVSDFGLCKKLEGNQSSFGATTGRAAGTSGWRAPELLLDDDGRDAGLAADASTHSGSGSVLVGDAGMP
HGRRATRAIDIFSLGLVFFYVLTNGSHPFDCGDRYMREVNIRKGNYNLGPLSSLGDFAWEAKDLITAMLNADPKQ
RPSAREIMSHPFFWPPKKRLSFLCDVSDHFEKEPRDPPSAALVELEKHAAQVTKGDFLRTMPPLFVDSLGKQRKY
TGSRLLDLLRALRNKRNHYEDMTDALKQMVGPLPEGYLSMWTVRFPMLLLVCWNVVYNVRWDETDRFREYYEPAG
L*
Coding >Hirsu2|7658
ATGCTGCGACGGCCGCCCGTCGAAGCGCGGGGGCTCTCGCAACAGCAGAAACTCTGGCTCGCCCTCGCCGTCTTC
CTCATCCCCTGGCTGCAACTGGCCGACGCCCAGCAGCAGCCGCAGCCGCGCCAACAACAACAAGATCATCATCAT
CGTCACCATCATGAGCAGCAGCAGCAGCATCCCCACGCCATCGCCCACCCGGTTGTCGCCGGTCCGGGAGACCAT
GGCGGCAGCCAGCTTTCCGGCCAGAGCGCCGTCGCCCGGGATTGGCCCGCCGCTCGCCTCGACACCCCCGACACC
CCTCCCGACGCTGCTCTCGCCGACGCCGCTCTCGCCGACGCCGCTCTCGCCGACGCCGACGGCAGCAAGAAGCGT
CCGCCGGCCGCGAGTCCGCATGACCCGCCGGCCGGCCGCGCCACCGGCCAGCAGCCCCGCCGGCAGCCAGCCGAC
GGCGGCCGCCGCCAGACGCCCACCGATCTGATCAACAACAAGAAGCAACGCATTATCCCCGACGATGCGAGCGCC
CTCGCAACTTTGGCTCCGGCTCAGTCCGTCCGAGCACCACACCCTCCACGACATCATCGGCCCAGCAGCGTGCCT
GCCTCTGGGCTGGCCTCGCCGCAGCTTGCGCGGAGTCTGGAGGACTGGGAAGTGGAAGACTTCGTTCTTCTGGCG
ACCGTCGATGGAGACCTCTACGCCGCCGACCGCAAGACGGGCAAGCAGCGCTGGCACCTCGAGGTGGACCAGCCC
ATGGTCGAGACCATTCACCACCGCGCCAACCACTCCGTCCTCGACGACGACTACAGCCCCGTCGACCACTACATT
TGGGCCGTCGAGCCCAACCGCGACGGCGGCGTCTACGTCTGGGTCCCCAGCCCCGACGCCCGGCCCCGCGCCACC
GGCTTCACCATGAAGCGCCTGGTCGAGGAGCTGGCCCCCTACGCCGGCGAGGAGCCGTCCGTCGTCTACACCGGC
GACAAGAAGACGACCATGATCACCCTCGACGCCGCCACCGGCCGCGTCGTCAAGTGGTTCGGCTCCACCGGCTCC
CACGTCAACGAGGCCGAGAGCTGCCTGCGGCCCAACGCCCTCTACGACAAGGACGCCGCCGAGTGCAGCTCGACC
GGCACCATCACCCTCGGTAGGACCGAGTACACCGTCGGCATCCAGCGGCGCGACGGCCGGCCCATCGCCACCCTC
AAGTACGCCGAGTGGAGCCCCAACAACTACGACAACGACCTCTTCCAGCAGTACCACGTCTCGCTCGACAGCCGC
TACATCACCAGCCAGCACGACGGCAACATCTACTCCTTCGACTACGCCCGCACCGGCAGCGCCGCCCCCATCTTC
AGCCACAAGTTCGCCGCCCCCGTCGTCCGCGTCTTCGACGTCTGCCGTCCCTGGCAGGCCGCCGCCGAGACCAGC
CTCGAGCTCGTCGTCCTCCCCCAGCCCGCCATGCCGTCGCAGGACGAGAGCGTCGCCCGCATGCGGAGCAACAGC
GTCTTCCTCAACCAGACCGAGGGCGGCAGCTGGTACGCCCTCTCGGGGCGCCAGTACCCGCTCATCATCGAGGCC
CCCCTCGCCCAGGTCTCCTATCCCGGCTGGTGGGACCTGGCCTCCGCCTGGGACGACCTCACCGAGGCCAGCATC
TCAAAGGCCCTCGTCGGCACCCACTCCCTCGACAAGATCCGCCACGACTCGCCCCAGCCGCCGACCCTTCCCCAG
GGCACCATCACCGACGGCAACGAGGACCTGGACAACGACTCCAACCTGCCTGTGCTGCCAGAGGGCGAGCCGGAC
GAGCCGACAATCATCAACAAGGTCAAGGGGCTGCCGCAGAGCGCCGCGAACAGCGTCGTCGACTTCATCAGGAAC
CCCATCCTGTTTCTCCTCTTCTTCGCCGCCCTCGTGTACAACGAGAAGAAGCTTCGAAAGTCCTATCACCGCTGG
CGCTCGCACGGCAACTTGCGAGACACGCTGGCCTACCTCACGTCCGATGCCTCCGCCGACAAGGACGGACGCCAG
CTGCCCCAGGCCGACAGCACCGACGACGAGGACGCGAACAGGCAGCAGCCCGCCAACGACGAGGAGTCGCGCGAT
CGGAGCAAGAATGACGTCGGCGGCCAGCCGAACTCGGCCCAGCCAGCCGAAGTCCTTCCGCAGGGCGAAGAAGCC
GAGAGGCACACGCTCCCCGAGGCTCAGCCCGAGCACGGCGCCGGAGAGTCGAGGGACGAGGCCGGATCTCCAAAC
GGCGCGGCCGAGTCCTCTTCGCCGGGAACTGCCCCCGAGAAGAAGAAGAAGGCGCATCGGGGCAGACGCGGCGGC
GTCAAGCACCGCAAGGGCCGGGCCCGCGAGCAGTCTCAGTCCAGGGGGGACGACGAGGCGGCCCCCACGACGGTC
GAGGAGGCGGTCAACAACGCCAAGAAGCTGGGCGACAGGCCGAGCCTGGAGCCCGACGTCATGACCGTTGCCAAC
GACATGCAGGCCGTCACCGGGCCCATCATCCGGATGGGCAACATCGAGGTCAACACGAACGAACAGCTGGGAATC
GGAAGCAACGGAACTCTGGTCTTCGCCGGCCGCTTCGACGGACGCGAGGTTGCCGTCAAGCGGATGCTCATACAG
TTTTACGACATCGCCTCGCAGGAGACGAGGCTGCTGCGAGAGAGCGACGACCACCCCAATGTCATCCGCTACTAC
TCGCAGCAGATCCACGACGGCTTCCTGTACATCGCGCTGGAGCGCTGCGTGGCGTCGCTGGCCGAGGTTGTCGAT
CGGCCGCAGGACTTCCGCCAGATTGCCGAGGCCGGGAGCACCGACGTGCCGGGAGTCCTGTACCAGATCACCAAC
GGCATCAGCCACCTGCACTCGTTGCGGATCGTCCACCGGGATCTGAAGCCGCAGAACATTCTGGTCAACATGGGC
AAGGACGGCAAGCCTCGACTGCTCGTGTCCGACTTCGGCCTGTGCAAGAAGCTGGAAGGCAACCAATCTTCGTTT
GGGGCGACGACGGGCAGGGCGGCCGGCACGTCGGGATGGCGGGCCCCCGAGCTCCTGCTCGACGACGACGGGCGC
GACGCCGGCCTCGCCGCCGACGCCAGCACGCACAGCGGCTCCGGCTCCGTGCTCGTCGGCGACGCCGGGATGCCG
CACGGCAGGCGGGCCACGCGGGCCATCGACATCTTCTCCCTCGGCCTCGTCTTCTTCTACGTCCTGACGAACGGG
TCGCACCCGTTCGACTGCGGCGACCGCTACATGCGCGAGGTGAACATACGCAAGGGCAACTATAACCTCGGGCCG
CTGAGCTCGCTGGGCGACTTCGCGTGGGAGGCCAAGGACCTGATCACGGCCATGCTCAACGCGGACCCCAAGCAG
CGGCCGAGCGCACGGGAGATCATGTCGCACCCGTTCTTCTGGCCGCCGAAGAAGCGGCTGTCGTTCCTGTGCGAC
GTCTCGGACCACTTCGAGAAGGAGCCGCGGGACCCGCCGTCGGCGGCGCTGGTGGAGCTGGAGAAGCACGCGGCG
CAGGTGACCAAGGGCGACTTCCTGCGCACGATGCCGCCGCTGTTCGTCGACTCGCTGGGCAAGCAGCGCAAGTAC
ACGGGGTCGAGGCTGCTGGACCTGCTGCGGGCGCTGCGCAACAAGCGCAACCACTACGAGGACATGACGGACGCG
CTGAAGCAGATGGTCGGGCCGCTGCCGGAGGGCTACCTTAGCATGTGGACGGTGCGGTTCCCGATGCTGCTGCTG
GTTTGCTGGAACGTGGTGTACAACGTGCGCTGGGACGAGACGGACCGGTTCCGCGAGTACTACGAGCCGGCCGGG
CTGTAG
Transcript >Hirsu2|7658
ATGCTGCGACGGCCGCCCGTCGAAGCGCGGGGGCTCTCGCAACAGCAGAAACTCTGGCTCGCCCTCGCCGTCTTC
CTCATCCCCTGGCTGCAACTGGCCGACGCCCAGCAGCAGCCGCAGCCGCGCCAACAACAACAAGATCATCATCAT
CGTCACCATCATGAGCAGCAGCAGCAGCATCCCCACGCCATCGCCCACCCGGTTGTCGCCGGTCCGGGAGACCAT
GGCGGCAGCCAGCTTTCCGGCCAGAGCGCCGTCGCCCGGGATTGGCCCGCCGCTCGCCTCGACACCCCCGACACC
CCTCCCGACGCTGCTCTCGCCGACGCCGCTCTCGCCGACGCCGCTCTCGCCGACGCCGACGGCAGCAAGAAGCGT
CCGCCGGCCGCGAGTCCGCATGACCCGCCGGCCGGCCGCGCCACCGGCCAGCAGCCCCGCCGGCAGCCAGCCGAC
GGCGGCCGCCGCCAGACGCCCACCGATCTGATCAACAACAAGAAGCAACGCATTATCCCCGACGATGCGAGCGCC
CTCGCAACTTTGGCTCCGGCTCAGTCCGTCCGAGCACCACACCCTCCACGACATCATCGGCCCAGCAGCGTGCCT
GCCTCTGGGCTGGCCTCGCCGCAGCTTGCGCGGAGTCTGGAGGACTGGGAAGTGGAAGACTTCGTTCTTCTGGCG
ACCGTCGATGGAGACCTCTACGCCGCCGACCGCAAGACGGGCAAGCAGCGCTGGCACCTCGAGGTGGACCAGCCC
ATGGTCGAGACCATTCACCACCGCGCCAACCACTCCGTCCTCGACGACGACTACAGCCCCGTCGACCACTACATT
TGGGCCGTCGAGCCCAACCGCGACGGCGGCGTCTACGTCTGGGTCCCCAGCCCCGACGCCCGGCCCCGCGCCACC
GGCTTCACCATGAAGCGCCTGGTCGAGGAGCTGGCCCCCTACGCCGGCGAGGAGCCGTCCGTCGTCTACACCGGC
GACAAGAAGACGACCATGATCACCCTCGACGCCGCCACCGGCCGCGTCGTCAAGTGGTTCGGCTCCACCGGCTCC
CACGTCAACGAGGCCGAGAGCTGCCTGCGGCCCAACGCCCTCTACGACAAGGACGCCGCCGAGTGCAGCTCGACC
GGCACCATCACCCTCGGTAGGACCGAGTACACCGTCGGCATCCAGCGGCGCGACGGCCGGCCCATCGCCACCCTC
AAGTACGCCGAGTGGAGCCCCAACAACTACGACAACGACCTCTTCCAGCAGTACCACGTCTCGCTCGACAGCCGC
TACATCACCAGCCAGCACGACGGCAACATCTACTCCTTCGACTACGCCCGCACCGGCAGCGCCGCCCCCATCTTC
AGCCACAAGTTCGCCGCCCCCGTCGTCCGCGTCTTCGACGTCTGCCGTCCCTGGCAGGCCGCCGCCGAGACCAGC
CTCGAGCTCGTCGTCCTCCCCCAGCCCGCCATGCCGTCGCAGGACGAGAGCGTCGCCCGCATGCGGAGCAACAGC
GTCTTCCTCAACCAGACCGAGGGCGGCAGCTGGTACGCCCTCTCGGGGCGCCAGTACCCGCTCATCATCGAGGCC
CCCCTCGCCCAGGTCTCCTATCCCGGCTGGTGGGACCTGGCCTCCGCCTGGGACGACCTCACCGAGGCCAGCATC
TCAAAGGCCCTCGTCGGCACCCACTCCCTCGACAAGATCCGCCACGACTCGCCCCAGCCGCCGACCCTTCCCCAG
GGCACCATCACCGACGGCAACGAGGACCTGGACAACGACTCCAACCTGCCTGTGCTGCCAGAGGGCGAGCCGGAC
GAGCCGACAATCATCAACAAGGTCAAGGGGCTGCCGCAGAGCGCCGCGAACAGCGTCGTCGACTTCATCAGGAAC
CCCATCCTGTTTCTCCTCTTCTTCGCCGCCCTCGTGTACAACGAGAAGAAGCTTCGAAAGTCCTATCACCGCTGG
CGCTCGCACGGCAACTTGCGAGACACGCTGGCCTACCTCACGTCCGATGCCTCCGCCGACAAGGACGGACGCCAG
CTGCCCCAGGCCGACAGCACCGACGACGAGGACGCGAACAGGCAGCAGCCCGCCAACGACGAGGAGTCGCGCGAT
CGGAGCAAGAATGACGTCGGCGGCCAGCCGAACTCGGCCCAGCCAGCCGAAGTCCTTCCGCAGGGCGAAGAAGCC
GAGAGGCACACGCTCCCCGAGGCTCAGCCCGAGCACGGCGCCGGAGAGTCGAGGGACGAGGCCGGATCTCCAAAC
GGCGCGGCCGAGTCCTCTTCGCCGGGAACTGCCCCCGAGAAGAAGAAGAAGGCGCATCGGGGCAGACGCGGCGGC
GTCAAGCACCGCAAGGGCCGGGCCCGCGAGCAGTCTCAGTCCAGGGGGGACGACGAGGCGGCCCCCACGACGGTC
GAGGAGGCGGTCAACAACGCCAAGAAGCTGGGCGACAGGCCGAGCCTGGAGCCCGACGTCATGACCGTTGCCAAC
GACATGCAGGCCGTCACCGGGCCCATCATCCGGATGGGCAACATCGAGGTCAACACGAACGAACAGCTGGGAATC
GGAAGCAACGGAACTCTGGTCTTCGCCGGCCGCTTCGACGGACGCGAGGTTGCCGTCAAGCGGATGCTCATACAG
TTTTACGACATCGCCTCGCAGGAGACGAGGCTGCTGCGAGAGAGCGACGACCACCCCAATGTCATCCGCTACTAC
TCGCAGCAGATCCACGACGGCTTCCTGTACATCGCGCTGGAGCGCTGCGTGGCGTCGCTGGCCGAGGTTGTCGAT
CGGCCGCAGGACTTCCGCCAGATTGCCGAGGCCGGGAGCACCGACGTGCCGGGAGTCCTGTACCAGATCACCAAC
GGCATCAGCCACCTGCACTCGTTGCGGATCGTCCACCGGGATCTGAAGCCGCAGAACATTCTGGTCAACATGGGC
AAGGACGGCAAGCCTCGACTGCTCGTGTCCGACTTCGGCCTGTGCAAGAAGCTGGAAGGCAACCAATCTTCGTTT
GGGGCGACGACGGGCAGGGCGGCCGGCACGTCGGGATGGCGGGCCCCCGAGCTCCTGCTCGACGACGACGGGCGC
GACGCCGGCCTCGCCGCCGACGCCAGCACGCACAGCGGCTCCGGCTCCGTGCTCGTCGGCGACGCCGGGATGCCG
CACGGCAGGCGGGCCACGCGGGCCATCGACATCTTCTCCCTCGGCCTCGTCTTCTTCTACGTCCTGACGAACGGG
TCGCACCCGTTCGACTGCGGCGACCGCTACATGCGCGAGGTGAACATACGCAAGGGCAACTATAACCTCGGGCCG
CTGAGCTCGCTGGGCGACTTCGCGTGGGAGGCCAAGGACCTGATCACGGCCATGCTCAACGCGGACCCCAAGCAG
CGGCCGAGCGCACGGGAGATCATGTCGCACCCGTTCTTCTGGCCGCCGAAGAAGCGGCTGTCGTTCCTGTGCGAC
GTCTCGGACCACTTCGAGAAGGAGCCGCGGGACCCGCCGTCGGCGGCGCTGGTGGAGCTGGAGAAGCACGCGGCG
CAGGTGACCAAGGGCGACTTCCTGCGCACGATGCCGCCGCTGTTCGTCGACTCGCTGGGCAAGCAGCGCAAGTAC
ACGGGGTCGAGGCTGCTGGACCTGCTGCGGGCGCTGCGCAACAAGCGCAACCACTACGAGGACATGACGGACGCG
CTGAAGCAGATGGTCGGGCCGCTGCCGGAGGGCTACCTTAGCATGTGGACGGTGCGGTTCCCGATGCTGCTGCTG
GTTTGCTGGAACGTGGTGTACAACGTGCGCTGGGACGAGACGGACCGGTTCCGCGAGTACTACGAGCCGGCCGGG
CTGTAG
Gene >Hirsu2|7658
ATGCTGCGACGGCCGCCCGTCGAAGCGCGGGGGCTCTCGCAACAGCAGAAACTCTGGCTCGCCCTCGCCGTCTTC
CTCATCCCCTGGCTGCAACTGGCCGACGCCCAGCAGCAGCCGCAGCCGCGCCAACAACAACAAGATCATCATCAT
CGTCACCATCATGAGCAGCAGCAGCAGCATCCCCACGCCATCGCCCACCCGGTTGTCGCCGGTCCGGGAGACCAT
GGCGGCAGCCAGCTTTCCGGCCAGAGCGCCGTCGCCCGGGATTGGCCCGCCGCTCGCCTCGACACCCCCGACACC
CCTCCCGACGCTGCTCTCGCCGACGCCGCTCTCGCCGACGCCGCTCTCGCCGACGCCGACGGCAGCAAGAAGCGT
CCGCCGGCCGCGAGTCCGCATGACCCGCCGGCCGGCCGCGCCACCGGCCAGCAGCCCCGCCGGCAGCCAGCCGAC
GGCGGCCGCCGCCAGACGCCCACCGATCTGATCAACAACAAGAAGCAACGCATTATCCCCGACGATGCGAGCGCC
CTCGCAACTTTGGCTCCGGCTCAGTCCGTCCGAGCACCACACCCTCCACGACATCATCGGCCCAGCAGCGTGCCT
GCCTCTGGGCTGGCCTCGCCGCAGCTTGCGCGGAGTCTGGAGGACTGGGAAGTGGAAGACTTCGTTCTTCTGGCG
ACCGTCGATGGAGACCTCTACGCCGCCGACCGCAAGACGGGCAAGCAGCGCTGGCACCTCGAGGTGGACCAGCCC
ATGGTCGAGACCATTCACCACCGCGCCAACCACTCCGTCCTCGACGACGACTACAGCCCCGTCGACCACTACATT
TGGGCCGTCGAGCCCAACCGCGACGGCGGCGTCTACGTCTGGGTCCCCAGCCCCGACGCCCGGCCCCGCGCCACC
GGCTTCACCATGAAGCGCCTGGTCGAGGAGCTGGCCCCCTACGCCGGCGAGGAGCCGTCCGTCGTCTACACCGGC
GACAAGAAGACGACCATGATCACCCTCGACGCCGCCACCGGCCGCGTCGTCAAGTGGTTCGGCTCCACCGGCTCC
CACGTCAACGAGGCCGAGAGCTGCCTGCGGCCCAACGCCCTCTACGACAAGGACGCCGCCGAGTGCAGCTCGACC
GGCACCATCACCCTCGGTAGGACCGAGTACACCGTCGGCATCCAGCGGCGCGACGGCCGGCCCATCGCCACCCTC
AAGTACGCCGAGTGGAGCCCCAACAACTACGACAACGACCTCTTCCAGCAGTACCACGTCTCGCTCGACAGCCGC
TACATCACCAGCCAGCACGACGGCAACATCTACTCCTTCGACTACGCCCGCACCGGCAGCGCCGCCCCCATCTTC
AGCCACAAGTTCGCCGCCCCCGTCGTCCGCGTCTTCGACGTCTGCCGTCCCTGGCAGGCCGCCGCCGAGACCAGC
CTCGAGCTCGTCGTCCTCCCCCAGCCCGCCATGCCGTCGCAGGACGAGAGCGTCGCCCGCATGCGGAGCAACAGC
GTCTTCCTCAACCAGACCGAGGGCGGCAGCTGGTACGCCCTCTCGGGGCGCCAGTACCCGCTCATCATCGAGGCC
CCCCTCGCCCAGGTCTCCTATCCCGGCTGGTGGGACCTGGCCTCCGCCTGGGACGACCTCACCGAGGCCAGCATC
TCAAAGGCCCTCGTCGGCACCCACTCCCTCGACAAGATCCGCCACGACTCGCCCCAGCCGCCGACCCTTCCCCAG
GGCACCATCACCGACGGCAACGAGGACCTGGACAACGACTCCAACCTGCCTGTGCTGCCAGAGGGCGAGCCGGAC
GAGCCGACAATCATCAACAAGGTCAAGGGGCTGCCGCAGAGCGCCGCGAACAGCGTCGTCGACTTCATCAGGAAC
CCCATCCTGTTTCTCCTCTTCTTCGCCGCCCTCGTGTACAACGAGAAGAAGCTTCGAAAGTCCTATCACCGCTGG
CGCTCGCACGGCAACTTGCGAGACACGCTGGCCTACCTCACGTCCGATGCCTCCGCCGACAAGGACGGACGCCAG
CTGCCCCAGGCCGACAGCACCGACGACGAGGACGCGAACAGGCAGCAGCCCGCCAACGACGAGGAGTCGCGCGAT
CGGAGCAAGAATGACGTCGGCGGCCAGCCGAACTCGGCCCAGCCAGCCGAAGTCCTTCCGCAGGGCGAAGAAGCC
GAGAGGCACACGCTCCCCGAGGCTCAGCCCGAGCACGGCGCCGGAGAGTCGAGGGACGAGGCCGGATCTCCAAAC
GGCGCGGCCGAGTCCTCTTCGCCGGGAACTGCCCCCGAGAAGAAGAAGAAGGCGCATCGGGGCAGACGCGGCGGC
GTCAAGCACCGCAAGGGCCGGGCCCGCGAGCAGTCTCAGTCCAGGGGGGACGACGAGGCGGCCCCCACGACGGTC
GAGGAGGCGGTCAACAACGCCAAGAAGCTGGGCGACAGGCCGAGCCTGGAGCCCGACGTCATGACCGTTGCCAAC
GACATGCAGGCCGTCACCGGGCCCATCATCCGGATGGGCAACATCGAGGTCAACACGAACGAACAGCTGGGAATC
GGAAGCAACGGAACTCTGGTCTTCGCCGGCCGCTTCGACGGACGCGAGGTTGCCGTCAAGCGGATGCTCATACAG
TTTTACGACATCGCCTCGCAGGAGACGAGGCTGCTGCGAGAGAGCGACGACCACCCCAATGGTTCGTGCCGTCGG
CCCAGCCACCCGTGCTCCCTGTCTTCCATCCGCTCCCCCCCCCTCTCTCGCTGACCGATGTTGGCAGTCATCCGC
TACTACTCGCAGCAGATCCACGACGGCTTCCTGTACATCGCGCTGGAGCGCTGCGTGGCGTCGCTGGCCGAGGTT
GTCGATCGGCCGCAGGACTTCCGCCAGATTGCCGAGGCCGGGAGCACCGACGTGCCGGGAGTCCTGTACCAGATC
ACCAACGGCATCAGCCACCTGCACTCGTTGCGGATCGTCCACCGGGATCTGAAGCCGCAGAACATTCTGGTCAAC
ATGGGCAAGGACGGCAAGCCTCGACTGCTCGTGTCCGACTTCGGCCTGTGCAAGAAGCTGGAAGGCAACCAATCT
TCGTTTGGGGCGACGACGGGCAGGGCGGCCGGCACGTCGGGATGGCGGGCCCCCGAGCTCCTGCTCGACGACGAC
GGGCGCGACGCCGGCCTCGCCGCCGACGCCAGCACGCACAGCGGCTCCGGCTCCGTGCTCGTCGGCGACGCCGGG
ATGCCGCACGGCAGGCGGGCCACGCGGGCCATCGACATCTTCTCCCTCGGCCTCGTCTTCTTCTACGTCCTGACG
AACGGGTCGCACCCGTTCGACTGCGGCGACCGCTACATGCGCGAGGTGAACATACGCAAGGGCAACTATAACCTC
GGGCCGCTGAGCTCGCTGGGCGACTTCGCGTGGGAGGCCAAGGACCTGATCACGGCCATGCTCAACGCGGACCCC
AAGCAGCGGCCGAGCGCACGGGAGATCATGTCGCACCCGTTCTTCTGGCCGCCGAAGAAGCGGCTGTCGTTCCTG
TGCGACGTCTCGGACCACTTCGAGAAGGAGCCGCGGGACCCGCCGTCGGCGGCGCTGGTGGAGCTGGAGAAGCAC
GCGGCGCAGGTGACCAAGGGCGACTTCCTGCGCACGATGCCGCCGCTGTTCGTCGACTCGCTGGGCAAGCAGCGC
AAGTACACGGGGTCGAGGCTGCTGGACCTGCTGCGGGCGCTGCGCAACAAGCGCAACCACTACGAGGACATGACG
GACGCGCTGAAGCAGATGGTCGGGCCGCTGCCGGAGGGCTACCTTAGCATGTGGACGGTGCGGTTCCCGATGCTG
CTGCTGGTTTGCTGGAACGTGGTGTACAACGTGCGCTGGGACGAGACGGACCGGTTCCGCGAGTACTACGAGCCG
GCCGGGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail