Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7652
Gene name
LocationContig_457:15079..16201
Strand-
Gene length (bp)1122
Transcript length (bp)813
Coding sequence length (bp)813
Protein length (aa) 271

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc) 2.0E-40 113 270

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40518|ARPC5_YEAST Actin-related protein 2/3 complex subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC15 PE=1 SV=1 123 270 2.0E-07

GO

GO Term Description Terminal node
GO:0034314 Arp2/3 complex-mediated actin nucleation Yes
GO:0030833 regulation of actin filament polymerization Yes
GO:0015629 actin cytoskeleton Yes
GO:0005885 Arp2/3 protein complex Yes
GO:0032535 regulation of cellular component size No
GO:0044446 intracellular organelle part No
GO:0005575 cellular_component No
GO:0009987 cellular process No
GO:0051128 regulation of cellular component organization No
GO:0008064 regulation of actin polymerization or depolymerization No
GO:0031334 positive regulation of protein complex assembly No
GO:0044430 cytoskeletal part No
GO:0032991 protein-containing complex No
GO:0051495 positive regulation of cytoskeleton organization No
GO:0043254 regulation of protein complex assembly No
GO:0044424 intracellular part No
GO:0016043 cellular component organization No
GO:0071840 cellular component organization or biogenesis No
GO:1902905 positive regulation of supramolecular fiber organization No
GO:0032273 positive regulation of protein polymerization No
GO:0051130 positive regulation of cellular component organization No
GO:0050789 regulation of biological process No
GO:0044464 cell part No
GO:0044087 regulation of cellular component biogenesis No
GO:0043228 non-membrane-bounded organelle No
GO:0065008 regulation of biological quality No
GO:0090066 regulation of anatomical structure size No
GO:0032271 regulation of protein polymerization No
GO:0043229 intracellular organelle No
GO:0051493 regulation of cytoskeleton organization No
GO:0005856 cytoskeleton No
GO:0030832 regulation of actin filament length No
GO:0065007 biological regulation No
GO:0032956 regulation of actin cytoskeleton organization No
GO:0010638 positive regulation of organelle organization No
GO:0030838 positive regulation of actin filament polymerization No
GO:0050794 regulation of cellular process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0007015 actin filament organization No
GO:0048518 positive regulation of biological process No
GO:0008150 biological_process No
GO:1902903 regulation of supramolecular fiber organization No
GO:0033043 regulation of organelle organization No
GO:0110053 regulation of actin filament organization No
GO:0045010 actin nucleation No
GO:0043226 organelle No
GO:0044422 organelle part No
GO:0044089 positive regulation of cellular component biogenesis No
GO:0032970 regulation of actin filament-based process No
GO:0097435 supramolecular fiber organization No
GO:0048522 positive regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7652
MTAGRIASLFSSGPAVVLVVVAVVVLARLVDALEAHVPPVARRRGRAQVQQPALGQLLLVAAAAGGAAEAAASVS
FRPDAAPLPSPVPMLRAVSPRLGSIDARLAPDRLRFSPAADVRHLAAQVRQLLRAGDAHGALRGCLETPVYNGPD
AAKEAHLQTIVEILQSIKASDMSPLLTAIYESPGGSECLDVLMKYIYKGMAVGSPAAALRSPSKVTPQSTGGFSQ
VGGRPGAANESTASSMSVLLSWHEKLVDVAGLGCIGRTMTDWRRV*
Coding >Hirsu2|7652
ATGACCGCCGGCAGGATCGCCTCCCTCTTCTCTTCAGGCCCCGCCGTGGTGCTCGTCGTCGTCGCTGTCGTCGTC
CTCGCCAGACTCGTCGACGCTCTCGAGGCGCACGTCCCACCAGTCGCGCGGCGCCGAGGCCGGGCGCAGGTGCAG
CAGCCGGCTCTCGGCCAGCTCCTCCTCGTCGCGGCGGCGGCGGGCGGCGCGGCCGAGGCGGCGGCGTCGGTCAGC
TTCAGGCCCGACGCCGCGCCGCTGCCGAGCCCGGTGCCGATGTTGAGGGCCGTCTCGCCCAGGTTGGGCAGCATC
GACGCCAGGCTGGCGCCCGACAGGTTGAGGTTCTCCCCCGCTGCCGACGTCCGCCACCTCGCCGCCCAGGTCCGG
CAGCTGCTGCGCGCCGGCGACGCCCACGGCGCCCTGCGCGGCTGTCTCGAGACGCCCGTCTACAACGGGCCCGAC
GCCGCCAAGGAGGCCCACCTGCAGACCATCGTCGAGATCCTCCAGTCCATCAAGGCCAGCGACATGAGCCCCCTG
CTCACGGCCATCTACGAGTCCCCCGGCGGCAGCGAATGCCTGGACGTGCTGATGAAGTACATCTACAAGGGCATG
GCGGTGGGCAGTCCCGCCGCCGCGCTGCGGTCGCCCTCCAAGGTCACGCCGCAGTCCACCGGCGGCTTCAGCCAG
GTCGGCGGCCGGCCCGGCGCGGCCAACGAGTCCACCGCCTCGTCCATGAGCGTCCTGCTGAGCTGGCACGAGAAG
CTCGTCGACGTCGCCGGCCTGGGCTGCATCGGGCGCACCATGACGGACTGGCGCAGGGTGTAG
Transcript >Hirsu2|7652
ATGACCGCCGGCAGGATCGCCTCCCTCTTCTCTTCAGGCCCCGCCGTGGTGCTCGTCGTCGTCGCTGTCGTCGTC
CTCGCCAGACTCGTCGACGCTCTCGAGGCGCACGTCCCACCAGTCGCGCGGCGCCGAGGCCGGGCGCAGGTGCAG
CAGCCGGCTCTCGGCCAGCTCCTCCTCGTCGCGGCGGCGGCGGGCGGCGCGGCCGAGGCGGCGGCGTCGGTCAGC
TTCAGGCCCGACGCCGCGCCGCTGCCGAGCCCGGTGCCGATGTTGAGGGCCGTCTCGCCCAGGTTGGGCAGCATC
GACGCCAGGCTGGCGCCCGACAGGTTGAGGTTCTCCCCCGCTGCCGACGTCCGCCACCTCGCCGCCCAGGTCCGG
CAGCTGCTGCGCGCCGGCGACGCCCACGGCGCCCTGCGCGGCTGTCTCGAGACGCCCGTCTACAACGGGCCCGAC
GCCGCCAAGGAGGCCCACCTGCAGACCATCGTCGAGATCCTCCAGTCCATCAAGGCCAGCGACATGAGCCCCCTG
CTCACGGCCATCTACGAGTCCCCCGGCGGCAGCGAATGCCTGGACGTGCTGATGAAGTACATCTACAAGGGCATG
GCGGTGGGCAGTCCCGCCGCCGCGCTGCGGTCGCCCTCCAAGGTCACGCCGCAGTCCACCGGCGGCTTCAGCCAG
GTCGGCGGCCGGCCCGGCGCGGCCAACGAGTCCACCGCCTCGTCCATGAGCGTCCTGCTGAGCTGGCACGAGAAG
CTCGTCGACGTCGCCGGCCTGGGCTGCATCGGGCGCACCATGACGGACTGGCGCAGGGTGTAG
Gene >Hirsu2|7652
ATGACCGCCGGCAGGATCGCCTCCCTCTTCTCTTCAGGCCCCGCCGTGGTGCTCGTCGTCGTCGCTGTCGTCGTC
CTCGCCAGACTCGTCGACGCTCTCGAGGCGCACGTCCCACCAGTCGCGCGGCGCCGAGGCCGGGCGCAGGTGCAG
CAGCCGGCTCTCGGCCAGCTCCTCCTCGTCGCGGCGGCGGCGGGCGGCGCGGCCGAGGCGGCGGCGTCGGTCAGC
TTCAGGCCCGACGCCGCGCCGCTGCCGAGCCCGGTGCCGATGTTGAGGGCCGTCTCGCCCAGGTTGGGCAGCATC
GACGCCAGGCTGGCGCCCGACAGGTTGAGGTTCTCCGTCAGCGACTTGCTGGCGCCGAAGCCCAGGCTGCCGACG
ATGCCGGCGAGGCCCGAGTCGTTGCTCTCCGGGCGCGCGGCGCCGCTCGGCATCAGCTGCAGGCCCATGGCCGCC
CCGTTGCCCAGCCCGCTGCCGACGTCCGCCACCTCGCCGCCCAGGTCCGGCAGCTGCTGCGCGCCGGCGACGCCC
ACGGCGCCCTGCGCGGCTGTCTCGAGACGCCCGTCTACAACGGGCCCGACGCCGCCAAGGTGAGGCCCAGAAGCA
GGCGAAGAAGAAGGAGGAAGACGAGGGGCGAGTCTACCGACGGGGCGCAGCGTCGCTGACGGCGAGGCCCGTCCC
CCCTCCCCCCCCCTCCTCCCTAGGAGGCCCACCTGCAGACCATCGTCGAGATCCTCCAGTCCATCAAGGCCAGCG
ACATGAGCCCCCTGCTCACGGCCATCTACGAGTCCCCCGGCGGCAGCGAATGCCTGGACGTGCTGATGAAGTACA
TGTGCGCCGCCGCCCTCCGCCCGCCCCCTCCCCCCGTCCGGCTCGACGCTGACCGACCCTCCCGCCCGCAGCTAC
AAGGGCATGGCGGTGGGCAGTCCCGCCGCCGCGCTGCGGTCGCCCTCCAAGGTCACGCCGCAGTCCACCGGCGGC
TTCAGCCAGGTCGGCGGCCGGCCCGGCGCGGCCAACGAGTCCACCGCCTCGTCCATGAGCGTCCTGCTGAGCTGG
CACGAGAAGCTCGTCGACGTCGCCGGCCTGGGCTGCATCGGGCGCACCATGACGGACTGGCGCAGGGTGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail