Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7650
Gene name
LocationContig_457:9293..12444
Strand-
Gene length (bp)3151
Transcript length (bp)2946
Coding sequence length (bp)2946
Protein length (aa) 982

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01602 Adaptin_N Adaptin N terminal region 5.4E-123 38 590
PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain 4.9E-44 830 947
PF02883 Alpha_adaptinC2 Adaptin C-terminal domain 1.0E-14 718 824

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P17427|AP2A2_MOUSE AP-2 complex subunit alpha-2 OS=Mus musculus GN=Ap2a2 PE=1 SV=2 14 952 0.0E+00
sp|P18484|AP2A2_RAT AP-2 complex subunit alpha-2 OS=Rattus norvegicus GN=Ap2a2 PE=1 SV=3 14 952 0.0E+00
sp|Q86KI1|AP2A2_DICDI AP-2 complex subunit alpha-2 OS=Dictyostelium discoideum GN=ap2a1-1 PE=3 SV=1 15 606 0.0E+00
sp|Q8LPK4|AP2A2_ARATH AP-2 complex subunit alpha-2 OS=Arabidopsis thaliana GN=ALPHAC-AD PE=1 SV=1 19 954 0.0E+00
sp|Q8LPL6|AP2A1_ARATH AP-2 complex subunit alpha-1 OS=Arabidopsis thaliana GN=ALPHA-ADR PE=1 SV=1 19 954 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P17427|AP2A2_MOUSE AP-2 complex subunit alpha-2 OS=Mus musculus GN=Ap2a2 PE=1 SV=2 14 952 0.0E+00
sp|P18484|AP2A2_RAT AP-2 complex subunit alpha-2 OS=Rattus norvegicus GN=Ap2a2 PE=1 SV=3 14 952 0.0E+00
sp|Q86KI1|AP2A2_DICDI AP-2 complex subunit alpha-2 OS=Dictyostelium discoideum GN=ap2a1-1 PE=3 SV=1 15 606 0.0E+00
sp|Q8LPK4|AP2A2_ARATH AP-2 complex subunit alpha-2 OS=Arabidopsis thaliana GN=ALPHAC-AD PE=1 SV=1 19 954 0.0E+00
sp|Q8LPL6|AP2A1_ARATH AP-2 complex subunit alpha-1 OS=Arabidopsis thaliana GN=ALPHA-ADR PE=1 SV=1 19 954 0.0E+00
sp|Q9C0W7|AP2A_SCHPO AP-2 complex subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apl3 PE=3 SV=1 18 952 0.0E+00
sp|P17426|AP2A1_MOUSE AP-2 complex subunit alpha-1 OS=Mus musculus GN=Ap2a1 PE=1 SV=1 14 952 0.0E+00
sp|Q7QG73|AP2A_ANOGA AP-2 complex subunit alpha OS=Anopheles gambiae GN=alpha-Adaptin PE=3 SV=4 19 952 0.0E+00
sp|O95782|AP2A1_HUMAN AP-2 complex subunit alpha-1 OS=Homo sapiens GN=AP2A1 PE=1 SV=3 14 952 0.0E+00
sp|P91926|AP2A_DROME AP-2 complex subunit alpha OS=Drosophila melanogaster GN=AP-2alpha PE=1 SV=1 19 952 0.0E+00
sp|Q29N38|AP2A_DROPS AP-2 complex subunit alpha OS=Drosophila pseudoobscura pseudoobscura GN=alpha-Adaptin PE=3 SV=1 19 952 0.0E+00
sp|O94973|AP2A2_HUMAN AP-2 complex subunit alpha-2 OS=Homo sapiens GN=AP2A2 PE=1 SV=2 14 948 0.0E+00
sp|Q0VCK5|AP2A2_BOVIN AP-2 complex subunit alpha-2 OS=Bos taurus GN=AP2A2 PE=1 SV=1 14 952 0.0E+00
sp|P38065|AP2A_YEAST AP-2 complex subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APL3 PE=1 SV=1 19 921 3.0E-99
sp|Q8I8U2|AP1G_DICDI AP-1 complex subunit gamma OS=Dictyostelium discoideum GN=ap1g1 PE=1 SV=1 25 612 4.0E-82
sp|Q99128|AP1G1_USTMA AP-1 complex subunit gamma-1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=APL4 PE=3 SV=3 15 651 5.0E-78
sp|O43747|AP1G1_HUMAN AP-1 complex subunit gamma-1 OS=Homo sapiens GN=AP1G1 PE=1 SV=5 22 694 3.0E-73
sp|P22892|AP1G1_MOUSE AP-1 complex subunit gamma-1 OS=Mus musculus GN=Ap1g1 PE=1 SV=3 22 604 4.0E-73
sp|Q5R5M2|AP1G1_PONAB AP-1 complex subunit gamma-1 OS=Pongo abelii GN=AP1G1 PE=2 SV=1 22 694 4.0E-72
sp|O88512|AP1G2_MOUSE AP-1 complex subunit gamma-like 2 OS=Mus musculus GN=Ap1g2 PE=1 SV=2 22 609 2.0E-70
sp|O75843|AP1G2_HUMAN AP-1 complex subunit gamma-like 2 OS=Homo sapiens GN=AP1G2 PE=1 SV=1 22 610 3.0E-70
sp|Q9ZUI6|AP1G2_ARATH AP-1 complex subunit gamma-2 OS=Arabidopsis thaliana GN=At1g60070 PE=1 SV=2 22 685 2.0E-66
sp|Q84K16|AP1G1_ARATH AP-1 complex subunit gamma-1 OS=Arabidopsis thaliana GN=GAMMA-ADR PE=1 SV=1 14 608 4.0E-64
sp|Q9UU81|AP1G1_SCHPO AP-1 complex subunit gamma-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apl4 PE=3 SV=1 7 514 1.0E-56
sp|Q9UPM8|AP4E1_HUMAN AP-4 complex subunit epsilon-1 OS=Homo sapiens GN=AP4E1 PE=1 SV=2 5 583 4.0E-52
sp|Q80V94|AP4E1_MOUSE AP-4 complex subunit epsilon-1 OS=Mus musculus GN=Ap4e1 PE=1 SV=3 2 518 6.0E-52
sp|Q8L7A9|AP4E_ARATH AP-4 complex subunit epsilon OS=Arabidopsis thaliana GN=At1g31730 PE=1 SV=1 20 511 1.0E-51
sp|Q54WN0|AP3D_DICDI AP-3 complex subunit delta OS=Dictyostelium discoideum GN=ap3d1 PE=3 SV=1 20 511 1.0E-41
sp|O14617|AP3D1_HUMAN AP-3 complex subunit delta-1 OS=Homo sapiens GN=AP3D1 PE=1 SV=1 16 513 2.0E-37
sp|O54774|AP3D1_MOUSE AP-3 complex subunit delta-1 OS=Mus musculus GN=Ap3d1 PE=1 SV=1 16 517 1.0E-36
sp|Q865S1|AP3D1_BOVIN AP-3 complex subunit delta-1 OS=Bos taurus GN=AP3D1 PE=1 SV=2 16 457 1.0E-36
sp|P54362|AP3D_DROME AP-3 complex subunit delta OS=Drosophila melanogaster GN=g PE=1 SV=4 20 519 4.0E-36
sp|Q86KI1|AP2A2_DICDI AP-2 complex subunit alpha-2 OS=Dictyostelium discoideum GN=ap2a1-1 PE=3 SV=1 709 952 7.0E-33
sp|Q54VE0|AP4E_DICDI AP-4 complex subunit epsilon OS=Dictyostelium discoideum GN=ap4e1 PE=3 SV=1 19 447 2.0E-31
sp|Q12028|AP1G1_YEAST AP-1 complex subunit gamma-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APL4 PE=1 SV=1 21 606 2.0E-25
sp|Q9C744|AP3D_ARATH AP-3 complex subunit delta OS=Arabidopsis thaliana GN=DELTA-ADR PE=1 SV=1 12 448 7.0E-25
sp|Q9UTL8|AP3D_SCHPO AP-3 complex subunit delta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apl5 PE=3 SV=2 20 593 5.0E-22
sp|Q755A1|AP3D_ASHGO AP-3 complex subunit delta OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=APL5 PE=3 SV=1 20 604 5.0E-22
sp|Q08951|AP3D_YEAST AP-3 complex subunit delta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APL5 PE=1 SV=1 46 590 1.0E-21
[Show less]

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0030117 membrane coat Yes
GO:0030131 clathrin adaptor complex Yes
GO:0016192 vesicle-mediated transport Yes
GO:0005575 cellular_component No
GO:0071702 organic substance transport No
GO:0051649 establishment of localization in cell No
GO:0098796 membrane protein complex No
GO:0045184 establishment of protein localization No
GO:0015833 peptide transport No
GO:0071705 nitrogen compound transport No
GO:0008150 biological_process No
GO:0051641 cellular localization No
GO:0006810 transport No
GO:0008104 protein localization No
GO:0044425 membrane part No
GO:0033036 macromolecule localization No
GO:0046907 intracellular transport No
GO:0051179 localization No
GO:0015031 protein transport No
GO:0044464 cell part No
GO:0044444 cytoplasmic part No
GO:0030119 AP-type membrane coat adaptor complex No
GO:0042886 amide transport No
GO:0051234 establishment of localization No
GO:0044424 intracellular part No
GO:0032991 protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7650
MSASGSGFLGRSSSSNANMRGLVQFIADLRNARARELEEKRINKELANIRQKFKDGNLSGYHKKKYVCKLLYIYI
LGWNVDFGHLEAVNLISANKYSEKQIGYLAMTLFLHEKHELLHLVVNSIRKDLLDNNELFNCLALHAIANVGGRE
MGEALSGEVHRLLISPTSKSFVKKKAALTLLRLYRKHPGIVSPQWAERIIHLMDDADLGVALSVTSLVMTLAQDN
LEQYRGAYDKAAARLKRIIIDGEYTTDYLYYKVPCPWLQIKLLRLLQYFAPSNDSHVRKMIRACLERILNLAMEA
NKNVQQNNAQNAILFEAINLSIHLDTEHALMKQISTRLGRFIQSRETNVRYLGLEAMTHLAARSETLGPIKQHQD
IILGSLKDRDISVRRKGLDLLYSMCDATNARVIVGELLQYLQNADFAIREEMVLKIAILTEKYATDVQWYVDISL
RLIAMAGDHVSDEVWQRVIQIVTNNEELQVYAAQNILQHIKSDHCHETLVKIGAYLLGEFGHLIADQSRCSPIEQ
FMALQGKLTACSPGTRAMILSCFIKFVNLFPEIKPRLLHAFDVYSHTLDSEMQQRACEYLALARMPTDDLLRTVC
DEMPPFPERESALLSRLHQKHANTSDRRTWVVGGKDANTDTSELGMAKAGGLKRTFSSAAPVNGSGANGSNGQAL
AGLDMAAASAAEPKVPKVPNLASAAHLSPGWEEGFERLMQRYEGVLYEDGQVQVGIRSEYRGHRACFIAYFTNKA
PGPMTSFTTTLDLDDSEKGKLSWDVKMLAESTISPGGQSQQVTMFEAKRVFEKSPTIRVSYLAGALQALTLKLPV
AAHKFMHPAELSADDFFKRWKQIGTGPREAQEIFGLTTTVGKSHDRELTEEFVASTVQGFRWGLLDMVDPNPKNL
VGASVLHTSEGGQFGCLMRLEPNYGSQMIRLTIRATDDSVPSVLMKLMQERLASGRQLTPEPHHPPTQEEISDAF
RNVMVT*
Coding >Hirsu2|7650
ATGTCCGCCTCGGGCTCCGGCTTTCTCGGCCGCTCGAGCAGCAGCAATGCCAACATGCGCGGCCTCGTCCAGTTC
ATCGCCGACCTCCGCAATGCCCGCGCCCGCGAGCTCGAGGAGAAGCGGATCAACAAGGAGCTGGCCAACATTCGC
CAAAAGTTCAAGGACGGCAACCTCAGCGGCTACCACAAGAAGAAATACGTCTGCAAGCTGCTCTACATCTACATC
CTCGGCTGGAACGTCGACTTCGGTCACCTCGAGGCCGTCAATCTCATCTCGGCGAACAAGTACTCCGAGAAGCAG
ATCGGCTACCTGGCCATGACCCTCTTCCTCCACGAGAAACACGAGCTTCTGCACCTCGTCGTCAACAGCATCCGC
AAGGATCTTCTCGACAACAACGAGCTCTTCAACTGCCTGGCCCTCCACGCCATTGCCAACGTAGGGGGCCGCGAG
ATGGGCGAGGCGCTGAGCGGAGAGGTCCACAGGTTACTGATTTCGCCCACGTCCAAGTCCTTTGTCAAGAAGAAG
GCTGCCCTCACCCTGCTTCGACTCTACCGAAAGCACCCCGGCATCGTGTCGCCGCAATGGGCCGAGCGTATCATC
CACCTGATGGACGACGCAGATTTGGGCGTCGCGCTCTCCGTCACCTCCCTCGTCATGACGCTGGCGCAGGACAAC
CTCGAGCAGTACCGGGGCGCATACGACAAGGCGGCGGCGCGGTTGAAGCGAATCATCATCGACGGAGAGTACACC
ACCGACTACCTGTACTACAAGGTTCCCTGCCCCTGGCTGCAAATCAAGCTCCTGAGGCTGTTGCAGTATTTCGCA
CCCTCTAATGATTCCCACGTACGCAAGATGATTCGAGCATGCCTGGAGAGGATCCTCAACCTGGCCATGGAGGCC
AATAAGAACGTCCAACAGAACAATGCGCAGAATGCAATTCTCTTCGAGGCCATCAACTTGAGCATTCACCTGGAT
ACAGAGCACGCTCTGATGAAGCAGATTTCGACTCGGCTCGGTCGTTTCATCCAGAGCAGGGAGACCAATGTGCGT
TATCTGGGCCTCGAGGCCATGACGCACCTGGCCGCGCGTTCGGAAACCCTCGGACCCATCAAGCAGCACCAGGAC
ATCATCTTGGGGTCCTTGAAGGACCGAGACATCAGCGTGCGCCGGAAGGGCCTGGACCTCCTGTACAGCATGTGT
GACGCCACGAACGCGCGCGTCATCGTCGGCGAGCTGCTGCAGTACCTGCAGAATGCCGACTTTGCCATACGCGAG
GAGATGGTCCTCAAGATCGCCATCCTGACCGAAAAGTACGCCACGGACGTGCAGTGGTACGTGGACATATCTCTA
CGCCTCATTGCCATGGCCGGAGACCACGTCAGCGACGAGGTCTGGCAGCGCGTCATCCAGATCGTGACGAACAAC
GAAGAGCTCCAAGTCTATGCCGCACAGAACATTCTGCAGCACATCAAGTCGGACCACTGCCACGAGACGCTCGTC
AAGATAGGCGCCTACCTCCTCGGGGAGTTCGGCCACCTGATCGCCGACCAATCCCGCTGCAGCCCGATCGAACAG
TTCATGGCCCTCCAGGGCAAACTCACTGCCTGCTCGCCCGGCACGCGCGCCATGATCCTGTCCTGCTTCATCAAG
TTTGTCAACCTGTTTCCCGAAATCAAGCCGCGGCTCCTGCACGCCTTCGACGTCTACAGCCACACCCTGGACTCG
GAGATGCAGCAGAGGGCCTGCGAGTACCTCGCGCTGGCGAGGATGCCCACGGACGACCTCCTGAGGACCGTCTGC
GACGAGATGCCGCCGTTTCCCGAGCGGGAATCCGCGCTGCTGTCCAGACTGCACCAGAAGCATGCCAATACCAGC
GACCGCCGCACCTGGGTTGTCGGGGGCAAAGACGCAAACACCGACACCTCGGAGCTCGGCATGGCCAAGGCCGGA
GGCCTGAAGCGGACCTTCAGCTCGGCCGCCCCCGTAAACGGCAGCGGGGCGAACGGCTCGAACGGGCAGGCCCTC
GCGGGGCTGGACATGGCCGCCGCCTCTGCCGCCGAGCCTAAGGTGCCCAAGGTGCCCAATCTGGCCAGTGCCGCG
CACCTGTCGCCCGGGTGGGAGGAGGGCTTTGAGAGACTCATGCAGAGGTACGAAGGGGTGCTCTACGAAGACGGC
CAAGTCCAGGTCGGGATACGATCCGAGTATCGCGGCCACCGGGCCTGTTTCATTGCCTACTTCACCAACAAGGCC
CCCGGACCCATGACCTCCTTCACGACGACCCTGGACTTGGACGACAGCGAAAAGGGCAAGCTCAGCTGGGACGTG
AAGATGCTGGCCGAGAGCACCATCAGCCCCGGCGGGCAGTCGCAACAGGTGACCATGTTCGAGGCGAAGAGGGTC
TTCGAAAAGAGCCCGACCATACGGGTGAGCTACCTGGCCGGCGCCCTGCAGGCTCTCACCCTCAAGCTGCCGGTG
GCGGCGCACAAGTTTATGCACCCGGCAGAGCTCTCGGCCGACGACTTCTTCAAGAGATGGAAGCAGATAGGAACC
GGCCCCCGCGAAGCCCAAGAGATATTCGGCCTGACTACTACTGTGGGGAAATCGCACGACCGGGAACTGACGGAA
GAATTCGTCGCCTCGACCGTCCAGGGTTTCCGGTGGGGTCTCCTGGACATGGTCGATCCCAATCCCAAGAATCTG
GTGGGAGCTAGCGTCCTCCACACGTCCGAGGGAGGCCAGTTCGGTTGTCTGATGAGGCTGGAGCCGAACTACGGT
AGCCAGATGATCCGACTGACTATTCGGGCGACGGACGACTCGGTCCCCTCCGTCTTGATGAAACTCATGCAGGAG
AGGCTTGCGTCGGGGAGACAGCTGACGCCCGAGCCGCATCATCCCCCAACCCAGGAAGAAATCTCGGATGCTTTC
CGTAATGTCATGGTCACATGA
Transcript >Hirsu2|7650
ATGTCCGCCTCGGGCTCCGGCTTTCTCGGCCGCTCGAGCAGCAGCAATGCCAACATGCGCGGCCTCGTCCAGTTC
ATCGCCGACCTCCGCAATGCCCGCGCCCGCGAGCTCGAGGAGAAGCGGATCAACAAGGAGCTGGCCAACATTCGC
CAAAAGTTCAAGGACGGCAACCTCAGCGGCTACCACAAGAAGAAATACGTCTGCAAGCTGCTCTACATCTACATC
CTCGGCTGGAACGTCGACTTCGGTCACCTCGAGGCCGTCAATCTCATCTCGGCGAACAAGTACTCCGAGAAGCAG
ATCGGCTACCTGGCCATGACCCTCTTCCTCCACGAGAAACACGAGCTTCTGCACCTCGTCGTCAACAGCATCCGC
AAGGATCTTCTCGACAACAACGAGCTCTTCAACTGCCTGGCCCTCCACGCCATTGCCAACGTAGGGGGCCGCGAG
ATGGGCGAGGCGCTGAGCGGAGAGGTCCACAGGTTACTGATTTCGCCCACGTCCAAGTCCTTTGTCAAGAAGAAG
GCTGCCCTCACCCTGCTTCGACTCTACCGAAAGCACCCCGGCATCGTGTCGCCGCAATGGGCCGAGCGTATCATC
CACCTGATGGACGACGCAGATTTGGGCGTCGCGCTCTCCGTCACCTCCCTCGTCATGACGCTGGCGCAGGACAAC
CTCGAGCAGTACCGGGGCGCATACGACAAGGCGGCGGCGCGGTTGAAGCGAATCATCATCGACGGAGAGTACACC
ACCGACTACCTGTACTACAAGGTTCCCTGCCCCTGGCTGCAAATCAAGCTCCTGAGGCTGTTGCAGTATTTCGCA
CCCTCTAATGATTCCCACGTACGCAAGATGATTCGAGCATGCCTGGAGAGGATCCTCAACCTGGCCATGGAGGCC
AATAAGAACGTCCAACAGAACAATGCGCAGAATGCAATTCTCTTCGAGGCCATCAACTTGAGCATTCACCTGGAT
ACAGAGCACGCTCTGATGAAGCAGATTTCGACTCGGCTCGGTCGTTTCATCCAGAGCAGGGAGACCAATGTGCGT
TATCTGGGCCTCGAGGCCATGACGCACCTGGCCGCGCGTTCGGAAACCCTCGGACCCATCAAGCAGCACCAGGAC
ATCATCTTGGGGTCCTTGAAGGACCGAGACATCAGCGTGCGCCGGAAGGGCCTGGACCTCCTGTACAGCATGTGT
GACGCCACGAACGCGCGCGTCATCGTCGGCGAGCTGCTGCAGTACCTGCAGAATGCCGACTTTGCCATACGCGAG
GAGATGGTCCTCAAGATCGCCATCCTGACCGAAAAGTACGCCACGGACGTGCAGTGGTACGTGGACATATCTCTA
CGCCTCATTGCCATGGCCGGAGACCACGTCAGCGACGAGGTCTGGCAGCGCGTCATCCAGATCGTGACGAACAAC
GAAGAGCTCCAAGTCTATGCCGCACAGAACATTCTGCAGCACATCAAGTCGGACCACTGCCACGAGACGCTCGTC
AAGATAGGCGCCTACCTCCTCGGGGAGTTCGGCCACCTGATCGCCGACCAATCCCGCTGCAGCCCGATCGAACAG
TTCATGGCCCTCCAGGGCAAACTCACTGCCTGCTCGCCCGGCACGCGCGCCATGATCCTGTCCTGCTTCATCAAG
TTTGTCAACCTGTTTCCCGAAATCAAGCCGCGGCTCCTGCACGCCTTCGACGTCTACAGCCACACCCTGGACTCG
GAGATGCAGCAGAGGGCCTGCGAGTACCTCGCGCTGGCGAGGATGCCCACGGACGACCTCCTGAGGACCGTCTGC
GACGAGATGCCGCCGTTTCCCGAGCGGGAATCCGCGCTGCTGTCCAGACTGCACCAGAAGCATGCCAATACCAGC
GACCGCCGCACCTGGGTTGTCGGGGGCAAAGACGCAAACACCGACACCTCGGAGCTCGGCATGGCCAAGGCCGGA
GGCCTGAAGCGGACCTTCAGCTCGGCCGCCCCCGTAAACGGCAGCGGGGCGAACGGCTCGAACGGGCAGGCCCTC
GCGGGGCTGGACATGGCCGCCGCCTCTGCCGCCGAGCCTAAGGTGCCCAAGGTGCCCAATCTGGCCAGTGCCGCG
CACCTGTCGCCCGGGTGGGAGGAGGGCTTTGAGAGACTCATGCAGAGGTACGAAGGGGTGCTCTACGAAGACGGC
CAAGTCCAGGTCGGGATACGATCCGAGTATCGCGGCCACCGGGCCTGTTTCATTGCCTACTTCACCAACAAGGCC
CCCGGACCCATGACCTCCTTCACGACGACCCTGGACTTGGACGACAGCGAAAAGGGCAAGCTCAGCTGGGACGTG
AAGATGCTGGCCGAGAGCACCATCAGCCCCGGCGGGCAGTCGCAACAGGTGACCATGTTCGAGGCGAAGAGGGTC
TTCGAAAAGAGCCCGACCATACGGGTGAGCTACCTGGCCGGCGCCCTGCAGGCTCTCACCCTCAAGCTGCCGGTG
GCGGCGCACAAGTTTATGCACCCGGCAGAGCTCTCGGCCGACGACTTCTTCAAGAGATGGAAGCAGATAGGAACC
GGCCCCCGCGAAGCCCAAGAGATATTCGGCCTGACTACTACTGTGGGGAAATCGCACGACCGGGAACTGACGGAA
GAATTCGTCGCCTCGACCGTCCAGGGTTTCCGGTGGGGTCTCCTGGACATGGTCGATCCCAATCCCAAGAATCTG
GTGGGAGCTAGCGTCCTCCACACGTCCGAGGGAGGCCAGTTCGGTTGTCTGATGAGGCTGGAGCCGAACTACGGT
AGCCAGATGATCCGACTGACTATTCGGGCGACGGACGACTCGGTCCCCTCCGTCTTGATGAAACTCATGCAGGAG
AGGCTTGCGTCGGGGAGACAGCTGACGCCCGAGCCGCATCATCCCCCAACCCAGGAAGAAATCTCGGATGCTTTC
CGTAATGTCATGGTCACATGA
Gene >Hirsu2|7650
ATGTCCGCCTCGGGCTCCGGCTTTCTCGGCCGCTCGAGCAGCAGCAATGCCAACATGCGCGGCCTCGTCCAGTTC
ATCGCCGACCTCCGCAATGCCCGCGCCCGCGAGCTCGAGGAGAAGCGGATCAACAAGGAGCTGGCCAACATTCGC
CAAAAGTTCAAGGACGGCAACCTCAGCGGCTACCACAAGAAGAAATACGTCTGCAAGCTGCTCTACATCTACATC
CTCGGCTGGAACGTCGACTTCGGTCACCTCGAGGCCGTCAATCTCATCTCGGCGAACAAGTACTCCGAGAAGCAG
ATCGGCTACCTGGCCATGACCCTCTTCCTCCACGAGAAACACGAGCTTCTGCACCTCGTCGTCAACAGCATCCGC
AAGGATCTTCTCGACAACAACGAGCTCTTCAACTGCCTGGCCCTCCACGCCATTGCCAACGTAGGGGGCCGCGAG
ATGGGCGAGGCGCTGAGCGGAGAGGTCCACAGGTTACTGATTTCGCCGTGAGCTTTAAGCCCTCCCCCCCAAAAA
ACCGTTCGCTCTCACATCATGCGACCGAGGACTCTGACCACTCCGCAGCACGTCCAAGTCCTTTGTCAAGAAGAA
GGCTGCCCTCACCCTGCTTCGACTCTACCGAAAGCACCCCGGCATCGTGTCGCCGCAATGGGCCGAGCGTATCAT
CCACCTGATGGACGACGCAGATTTGGGCGTCGCGCTCTCCGTCACCTCCCTCGTCATGACGCTGGCGCAGGACAA
CCTCGAGCAGTACCGGGGCGCATACGACAAGGCGGCGGCGCGGTTGAAGCGAATCATCATCGACGGAGAGTACAC
CACCGACTACCTGTACTACAAGGTTCCCTGCCCCTGGCTGCAAATCAAGCTCCTGAGGCTGTTGCAGTATTTCGC
ACCCTCTAGTATGTTGCTGGCGTGGCACCCTTGCATCCGAGAAGATTCGACTCACGCGCCGTGACAGATGATTCC
CACGTACGCAAGATGATTCGAGCATGCCTGGAGAGGATCCTCAACCTGGCCATGGAGGCCAATAAGAACGTCCAA
CAGAACAATGCGCAGAATGCAATTCTCTTCGAGGCCATCAACTTGAGCATTCACCTGGATACAGAGCACGCTCTG
ATGAAGCAGATTTCGACTCGGCTCGGTCGTTTCATCCAGAGCAGGGAGACCAATGTGCGTTATCTGGGCCTCGAG
GCCATGACGCACCTGGCCGCGCGTTCGGAAACCCTCGGACCCATCAAGCAGCACCAGGACATCATCTTGGGGTCC
TTGAAGGACCGAGACATCAGCGTGCGCCGGAAGGGCCTGGACCTCCTGTACAGCATGTGTGACGCCACGAACGCG
CGCGTCATCGTCGGCGAGCTGCTGCAGTACCTGCAGAATGCCGACTTTGCCATACGCGAGGAGATGGTCCTCAAG
ATCGCCATCCTGACCGAAAAGTACGCCACGGACGTGCAGTGGTACGTGGACATATCTCTACGCCTCATTGCCATG
GCCGGAGACCACGTCAGCGACGAGGTCTGGCAGCGCGTCATCCAGATCGTGACGAACAACGAAGAGCTCCAAGTC
TATGCCGCACAGAACATTCTGCAGCACATCAAGTCGGACCACTGCCACGAGACGCTCGTCAAGATAGGCGCCTAC
CTCCTCGGGGAGTTCGGCCACCTGATCGCCGACCAATCCCGCTGCAGCCCGATCGAACAGTTCATGGCCCTCCAG
GGCAAACTCACTGCCTGCTCGCCCGGCACGCGCGCCATGATCCTGTCCTGCTTCATCAAGTTTGTCAACCTGTTT
CCCGAAATCAAGCCGCGGCTCCTGCACGCCTTCGACGTCTACAGCCACACCCTGGACTCGGAGATGCAGCAGAGG
GCCTGCGAGTACCTCGCGCTGGCGAGGATGCCCACGGACGACCTCCTGAGGACCGTCTGCGACGAGATGCCGCCG
TTTCCCGAGCGGGAATCCGCGCTGCTGTCCAGACTGCACCAGAAGCATGCCAATACCAGCGACCGCCGCACCTGG
GTTGTCGGGGGCAAAGACGCAAACACCGACACCTCGGAGCTCGGCATGGCCAAGGCCGGAGGCCTGAAGCGGACC
TTCAGCTCGGCCGCCCCCGTAAACGGCAGCGGGGCGAACGGCTCGAACGGGCAGGCCCTCGCGGGGCTGGACATG
GCCGCCGCCTCTGCCGCCGAGCCTAAGGTGCCCAAGGTGCCCAATCTGGCCAGTGCCGCGCACCTGTCGCCCGGG
TGGGAGGAGGGCTTTGAGAGACTCATGCAGAGGTACGAAGGGGTGCTCTACGAAGACGGCCAAGTCCAGGTCGGG
ATACGATCCGAGTATCGCGGCCACCGGGCCTGTTTCATTGCCTACTTCACCAACAAGGCCCCCGGACCCATGACC
TCCTTCACGACGACCCTGGACTTGGACGACAGCGAAAAGGGCAAGCTCAGCTGGGACGTGAAGATGCTGGCCGAG
AGCACCATCAGCCCCGGCGGGCAGTCGCAACAGGTGACCATGTTCGAGGCGAAGAGGGTCTTCGAAAAGAGCCCG
ACCATACGGGTGAGCTACCTGGCCGGCGCCCTGCAGGCTCTCACCCTCAAGCTGCCGGTGGCGGCGCACAAGTTT
ATGCACCCGGCAGAGCTCTCGGCCGACGACTTCTTCAAGAGATGGAAGCAGATAGGAACCGGCCCCCGCGAAGCC
CAAGAGATATTCGGCCTGACTACTACTGTGGGGAAATCGCACGACCGGGAACTGACGGAAGAATTCGTCGCCTCG
ACCGTCCAGGGTTTCCGGTGGGGTCTCCTGGACATGGTCGATCCCAATCCCAAGAATCTGGTGGGAGCTAGCGTC
CTCCACACGTCCGAGGGAGGCCAGTTCGGTTGTCTGATGAGGCTGGAGCCGAACTACGGTAGCCAGGTGAGCGAA
GCCAACCCCCCGTCCGTCCCTGTGCGTCTCCCGTGCGTGGCAGCTAACAAGGACGACGCAGATGATCCGACTGAC
TATTCGGGCGACGGACGACTCGGTCCCCTCCGTCTTGATGAAACTCATGCAGGAGAGGCTTGCGTCGGGGAGACA
GCTGACGCCCGAGCCGCATCATCCCCCAACCCAGGAAGAAATCTCGGATGCTTTCCGTAATGTCATGGTCACATG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail