Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7647
Gene name
LocationContig_457:3643..5373
Strand-
Gene length (bp)1730
Transcript length (bp)1656
Coding sequence length (bp)1656
Protein length (aa) 552

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08598 Sds3 Sds3-like 6.5E-23 37 236

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3037 0.9234 0.249 0.0442 0.0514 0.001 0.0166 0.0153 0.0103 0.0013

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3859
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3902
Ophiocordyceps australis map64 (Brazil) OphauB2|6517
Ophiocordyceps camponoti-floridani Ophcf2|06608
Ophiocordyceps camponoti-rufipedis Ophun1|3233
Ophiocordyceps kimflemingae Ophio5|5011
Ophiocordyceps subramaniannii Hirsu2|7647 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7647
MAAGDTATPPALGGRAERRSPLPASQSKRDRKRQIVMERLAVLTDKYQHDKDSAYRDQLQRIQIELNKLQKFDPY
AVNASEVAGDLQREFKQAVGTPVRAENARSLMEMAGVQFPQFTSDIQDVLEARDFQLTESKNEYERKVQEYKNTH
RFKIETAKREHEALNSTVRDRLINQLNTKKARLNKEKEAFEMSDTNALLLNPAQFSLTNPGSPGAHPGKRSTRNR
KEADSHDTYGENKKRKRNAGDDDGSPAPTRRALDANATTPYWQSEKARNEARKLGAVHTVASLFTEKELSMHYNT
AALAAHNFILRHRASGSASSAEGSDSGNGDNDAAADAEAPPSAPVMERQVSHATRSTRGAANHNFLEDRIVGVEA
ISSFELPSSLDLLHGADYNPKMPSSLPYQYIKNPVKSVEPSTPGPLSDKEISGDLQVMAYLKQYDLHHKPGSHLD
NPKGIRKTLEAVSVPYQTGTYVAFAKAPRELPPDSVAETLGMSLAATSSSVRDQPSPGPTTQPVNGQAATAAPMS
RQSSAGGVAMSRQGTTGSGRAKTRRS*
Coding >Hirsu2|7647
ATGGCTGCCGGCGACACGGCCACCCCCCCGGCCCTGGGCGGCAGGGCCGAGAGACGTTCGCCTCTTCCGGCGTCG
CAATCCAAGAGAGACCGCAAGCGACAGATCGTCATGGAACGCCTTGCCGTCCTGACCGACAAGTACCAGCACGAC
AAGGACTCGGCCTACCGCGACCAGCTGCAGCGGATACAGATCGAGCTTAACAAACTCCAAAAGTTCGACCCGTAC
GCCGTCAATGCCTCCGAGGTCGCGGGCGACCTCCAGCGCGAGTTCAAGCAGGCGGTGGGCACTCCGGTGCGCGCC
GAGAACGCCCGCAGCCTCATGGAGATGGCCGGGGTCCAGTTCCCTCAGTTCACGTCGGACATTCAGGATGTTCTG
GAGGCCCGCGACTTCCAACTTACCGAGTCTAAGAACGAGTACGAACGCAAAGTGCAGGAATACAAGAACACGCAC
AGATTCAAGATCGAGACGGCAAAACGCGAGCACGAGGCCCTCAATAGCACCGTGCGGGATCGTTTGATCAATCAA
CTCAATACGAAAAAAGCTCGCCTTAACAAGGAGAAGGAAGCGTTTGAGATGAGCGACACGAATGCCCTGCTTCTC
AATCCCGCCCAGTTCAGCCTCACCAACCCGGGCAGCCCCGGCGCTCACCCGGGCAAGCGGTCGACGCGCAATCGC
AAGGAAGCCGACAGCCACGACACGTACGGCGAGAACAAGAAGCGCAAGCGTAACGCCGGCGACGACGACGGTTCC
CCGGCGCCGACGCGCCGGGCGCTGGATGCTAATGCCACCACGCCCTACTGGCAATCCGAGAAGGCCCGCAACGAG
GCCCGGAAGCTGGGAGCCGTCCACACCGTCGCCAGCCTCTTCACCGAGAAGGAGCTCTCGATGCACTACAACACC
GCGGCCCTCGCGGCTCACAACTTCATCCTGCGTCACCGCGCCAGCGGCAGCGCCTCGTCCGCCGAAGGGAGCGAC
TCGGGCAACGGGGACAACGACGCGGCCGCGGATGCGGAGGCTCCGCCGTCGGCACCCGTAATGGAGCGGCAAGTC
TCGCACGCGACTAGGAGCACGCGCGGGGCGGCCAACCATAATTTTCTCGAAGACAGGATCGTCGGCGTCGAGGCC
ATCAGCAGCTTCGAGCTGCCCTCCAGCCTGGATCTGCTCCACGGGGCCGACTACAACCCCAAGATGCCGTCCTCC
TTGCCGTACCAATACATCAAGAACCCGGTCAAGTCCGTGGAACCGTCGACGCCCGGCCCACTGTCCGACAAGGAG
ATATCAGGGGACCTGCAGGTCATGGCGTACCTGAAGCAGTACGACCTCCATCACAAGCCCGGCAGCCATCTGGAC
AACCCCAAGGGGATCCGCAAGACGTTGGAGGCGGTCTCGGTTCCCTACCAAACGGGGACGTACGTCGCCTTCGCC
AAAGCCCCCCGAGAGCTCCCCCCGGACTCAGTAGCCGAGACGCTGGGCATGAGCCTCGCCGCCACCAGCAGCAGC
GTGCGAGACCAACCCAGCCCGGGACCGACGACGCAGCCCGTCAACGGCCAGGCGGCGACGGCGGCTCCCATGAGT
CGACAGAGCAGTGCCGGCGGCGTCGCCATGAGCCGACAGGGGACGACGGGGAGCGGCCGGGCGAAGACGCGTCGA
AGCTAG
Transcript >Hirsu2|7647
ATGGCTGCCGGCGACACGGCCACCCCCCCGGCCCTGGGCGGCAGGGCCGAGAGACGTTCGCCTCTTCCGGCGTCG
CAATCCAAGAGAGACCGCAAGCGACAGATCGTCATGGAACGCCTTGCCGTCCTGACCGACAAGTACCAGCACGAC
AAGGACTCGGCCTACCGCGACCAGCTGCAGCGGATACAGATCGAGCTTAACAAACTCCAAAAGTTCGACCCGTAC
GCCGTCAATGCCTCCGAGGTCGCGGGCGACCTCCAGCGCGAGTTCAAGCAGGCGGTGGGCACTCCGGTGCGCGCC
GAGAACGCCCGCAGCCTCATGGAGATGGCCGGGGTCCAGTTCCCTCAGTTCACGTCGGACATTCAGGATGTTCTG
GAGGCCCGCGACTTCCAACTTACCGAGTCTAAGAACGAGTACGAACGCAAAGTGCAGGAATACAAGAACACGCAC
AGATTCAAGATCGAGACGGCAAAACGCGAGCACGAGGCCCTCAATAGCACCGTGCGGGATCGTTTGATCAATCAA
CTCAATACGAAAAAAGCTCGCCTTAACAAGGAGAAGGAAGCGTTTGAGATGAGCGACACGAATGCCCTGCTTCTC
AATCCCGCCCAGTTCAGCCTCACCAACCCGGGCAGCCCCGGCGCTCACCCGGGCAAGCGGTCGACGCGCAATCGC
AAGGAAGCCGACAGCCACGACACGTACGGCGAGAACAAGAAGCGCAAGCGTAACGCCGGCGACGACGACGGTTCC
CCGGCGCCGACGCGCCGGGCGCTGGATGCTAATGCCACCACGCCCTACTGGCAATCCGAGAAGGCCCGCAACGAG
GCCCGGAAGCTGGGAGCCGTCCACACCGTCGCCAGCCTCTTCACCGAGAAGGAGCTCTCGATGCACTACAACACC
GCGGCCCTCGCGGCTCACAACTTCATCCTGCGTCACCGCGCCAGCGGCAGCGCCTCGTCCGCCGAAGGGAGCGAC
TCGGGCAACGGGGACAACGACGCGGCCGCGGATGCGGAGGCTCCGCCGTCGGCACCCGTAATGGAGCGGCAAGTC
TCGCACGCGACTAGGAGCACGCGCGGGGCGGCCAACCATAATTTTCTCGAAGACAGGATCGTCGGCGTCGAGGCC
ATCAGCAGCTTCGAGCTGCCCTCCAGCCTGGATCTGCTCCACGGGGCCGACTACAACCCCAAGATGCCGTCCTCC
TTGCCGTACCAATACATCAAGAACCCGGTCAAGTCCGTGGAACCGTCGACGCCCGGCCCACTGTCCGACAAGGAG
ATATCAGGGGACCTGCAGGTCATGGCGTACCTGAAGCAGTACGACCTCCATCACAAGCCCGGCAGCCATCTGGAC
AACCCCAAGGGGATCCGCAAGACGTTGGAGGCGGTCTCGGTTCCCTACCAAACGGGGACGTACGTCGCCTTCGCC
AAAGCCCCCCGAGAGCTCCCCCCGGACTCAGTAGCCGAGACGCTGGGCATGAGCCTCGCCGCCACCAGCAGCAGC
GTGCGAGACCAACCCAGCCCGGGACCGACGACGCAGCCCGTCAACGGCCAGGCGGCGACGGCGGCTCCCATGAGT
CGACAGAGCAGTGCCGGCGGCGTCGCCATGAGCCGACAGGGGACGACGGGGAGCGGCCGGGCGAAGACGCGTCGA
AGCTAG
Gene >Hirsu2|7647
ATGGCTGCCGGCGACACGGCCACCCCCCCGGCCCTGGGCGGCAGGGCCGAGAGACGTTCGCCTCTTCCGGCGTCG
CAATCCAAGAGAGACCGCAAGCGACAGATCGTCATGGAACGCCTTGCCGTCCTGACCGACAAGTACCAGCACGAC
AAGGACTCGGCCTACCGCGACCAGCTGCAGCGGATACAGATCGAGCTTAACAAACTCCAAAAGTTCGACCCGTAC
GCCGTCAATGCCTCCGAGGTCGCGGGCGACCTCCAGCGCGAGTTCAAGCAGGCGGTGGGCACTCCGGTGCGCGCC
GAGAACGCCCGCAGCCTCATGGAGATGGCCGGGGTCCAGTTCCCTCAGTTCACGTCGGACATTCAGGATGTTCTG
GAGGCCCGCGACTTCCAACTTACCGAGTCTAAGGTGACTCCAGCTTCTCCCCCCCATCTTGGTGTCTACAGGCAA
TGTCGCTGACCGGTATCCGTCCGCGTTCCCAGAACGAGTACGAACGCAAAGTGCAGGAATACAAGAACACGCACA
GATTCAAGATCGAGACGGCAAAACGCGAGCACGAGGCCCTCAATAGCACCGTGCGGGATCGTTTGATCAATCAAC
TCAATACGAAAAAAGCTCGCCTTAACAAGGAGAAGGAAGCGTTTGAGATGAGCGACACGAATGCCCTGCTTCTCA
ATCCCGCCCAGTTCAGCCTCACCAACCCGGGCAGCCCCGGCGCTCACCCGGGCAAGCGGTCGACGCGCAATCGCA
AGGAAGCCGACAGCCACGACACGTACGGCGAGAACAAGAAGCGCAAGCGTAACGCCGGCGACGACGACGGTTCCC
CGGCGCCGACGCGCCGGGCGCTGGATGCTAATGCCACCACGCCCTACTGGCAATCCGAGAAGGCCCGCAACGAGG
CCCGGAAGCTGGGAGCCGTCCACACCGTCGCCAGCCTCTTCACCGAGAAGGAGCTCTCGATGCACTACAACACCG
CGGCCCTCGCGGCTCACAACTTCATCCTGCGTCACCGCGCCAGCGGCAGCGCCTCGTCCGCCGAAGGGAGCGACT
CGGGCAACGGGGACAACGACGCGGCCGCGGATGCGGAGGCTCCGCCGTCGGCACCCGTAATGGAGCGGCAAGTCT
CGCACGCGACTAGGAGCACGCGCGGGGCGGCCAACCATAATTTTCTCGAAGACAGGATCGTCGGCGTCGAGGCCA
TCAGCAGCTTCGAGCTGCCCTCCAGCCTGGATCTGCTCCACGGGGCCGACTACAACCCCAAGATGCCGTCCTCCT
TGCCGTACCAATACATCAAGAACCCGGTCAAGTCCGTGGAACCGTCGACGCCCGGCCCACTGTCCGACAAGGAGA
TATCAGGGGACCTGCAGGTCATGGCGTACCTGAAGCAGTACGACCTCCATCACAAGCCCGGCAGCCATCTGGACA
ACCCCAAGGGGATCCGCAAGACGTTGGAGGCGGTCTCGGTTCCCTACCAAACGGGGACGTACGTCGCCTTCGCCA
AAGCCCCCCGAGAGCTCCCCCCGGACTCAGTAGCCGAGACGCTGGGCATGAGCCTCGCCGCCACCAGCAGCAGCG
TGCGAGACCAACCCAGCCCGGGACCGACGACGCAGCCCGTCAACGGCCAGGCGGCGACGGCGGCTCCCATGAGTC
GACAGAGCAGTGCCGGCGGCGTCGCCATGAGCCGACAGGGGACGACGGGGAGCGGCCGGGCGAAGACGCGTCGAA
GCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail