Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7635
Gene name
LocationContig_455:4590..9501
Strand+
Gene length (bp)4911
Transcript length (bp)4773
Coding sequence length (bp)4773
Protein length (aa) 1591

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 5.9E-13 402 492
PF13637 Ank_4 Ankyrin repeats (many copies) 2.0E-07 433 485
PF13606 Ank_3 Ankyrin repeat 5.7E-04 432 459
PF00023 Ank Ankyrin repeat 1.7E-04 432 462

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40480|HOS4_YEAST Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS4 PE=1 SV=1 395 721 2.0E-22
sp|Q6UB99|ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens GN=ANKRD11 PE=1 SV=3 398 502 2.0E-15
sp|Q6UB98|ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens GN=ANKRD12 PE=1 SV=3 398 503 8.0E-15
sp|Q9QZH2|BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1 398 524 7.0E-12
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 1086 1247 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40480|HOS4_YEAST Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS4 PE=1 SV=1 395 721 2.0E-22
sp|Q6UB99|ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens GN=ANKRD11 PE=1 SV=3 398 502 2.0E-15
sp|Q6UB98|ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens GN=ANKRD12 PE=1 SV=3 398 503 8.0E-15
sp|Q9QZH2|BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1 398 524 7.0E-12
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 1086 1247 1.0E-10
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 395 685 2.0E-10
sp|Q8CGN4|BCOR_MOUSE BCL-6 corepressor OS=Mus musculus GN=Bcor PE=1 SV=2 398 498 3.0E-10
sp|Q6W2J9|BCOR_HUMAN BCL-6 corepressor OS=Homo sapiens GN=BCOR PE=1 SV=1 398 498 4.0E-10
sp|O70445|BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus GN=Bard1 PE=2 SV=1 398 520 7.0E-10
sp|Q99728|BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens GN=BARD1 PE=1 SV=2 387 509 8.0E-10
sp|A2AQH4|BCORL_MOUSE BCL-6 corepressor-like protein 1 OS=Mus musculus GN=Bcorl1 PE=2 SV=1 398 517 1.0E-09
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 398 644 1.0E-09
sp|Q8IID4|DYHC2_PLAF7 Dynein heavy chain-like protein PF11_0240 OS=Plasmodium falciparum (isolate 3D7) GN=PF11_0240 PE=3 SV=1 1099 1266 2.0E-09
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 1124 1275 3.0E-09
sp|Q5E7L5|IF2_VIBF1 Translation initiation factor IF-2 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=infB PE=3 SV=1 1068 1203 4.0E-09
sp|Q8N7Z5|ANR31_HUMAN Putative ankyrin repeat domain-containing protein 31 OS=Homo sapiens GN=ANKRD31 PE=5 SV=2 395 503 4.0E-09
sp|B5FA79|IF2_VIBFM Translation initiation factor IF-2 OS=Vibrio fischeri (strain MJ11) GN=infB PE=3 SV=1 1068 1203 9.0E-09
sp|Q75CK5|NST1_ASHGO Stress response protein NST1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NST1 PE=3 SV=2 1139 1248 1.0E-08
sp|B5FA79|IF2_VIBFM Translation initiation factor IF-2 OS=Vibrio fischeri (strain MJ11) GN=infB PE=3 SV=1 1061 1197 5.0E-08
sp|Q6NZL6|TONSL_MOUSE Tonsoku-like protein OS=Mus musculus GN=Tonsl PE=1 SV=2 398 507 3.0E-07
sp|Q3IJ53|IF2_PSEHT Translation initiation factor IF-2 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=infB PE=3 SV=1 1071 1191 4.0E-07
sp|C4L8X4|IF2_TOLAT Translation initiation factor IF-2 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=infB PE=3 SV=1 1067 1195 6.0E-07
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 395 516 1.0E-06
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 1174 1270 1.0E-06
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 1143 1269 1.0E-06
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 400 488 2.0E-06
sp|A7MZI5|IF2_VIBCB Translation initiation factor IF-2 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=infB PE=3 SV=1 1056 1180 2.0E-06
sp|Q3IJ53|IF2_PSEHT Translation initiation factor IF-2 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=infB PE=3 SV=1 1110 1238 2.0E-06
sp|B5FA79|IF2_VIBFM Translation initiation factor IF-2 OS=Vibrio fischeri (strain MJ11) GN=infB PE=3 SV=1 1060 1184 3.0E-06
sp|B7VJH7|IF2_VIBTL Translation initiation factor IF-2 OS=Vibrio tasmaniensis (strain LGP32) GN=infB PE=3 SV=1 1056 1159 3.0E-06
sp|P04928|SANT_PLAFN S-antigen protein OS=Plasmodium falciparum (isolate NF7 / Ghana) PE=4 SV=1 1068 1194 3.0E-06
sp|P46504|YLX8_CAEEL Uncharacterized protein F23F12.8 OS=Caenorhabditis elegans GN=F23F12.8 PE=3 SV=2 1057 1237 5.0E-06
sp|Q8IID4|DYHC2_PLAF7 Dynein heavy chain-like protein PF11_0240 OS=Plasmodium falciparum (isolate 3D7) GN=PF11_0240 PE=3 SV=1 1046 1192 5.0E-06
sp|Q5E7L5|IF2_VIBF1 Translation initiation factor IF-2 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=infB PE=3 SV=1 1050 1184 6.0E-06
sp|C4L8X4|IF2_TOLAT Translation initiation factor IF-2 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=infB PE=3 SV=1 1078 1215 7.0E-06
sp|P33332|SEC3_YEAST Exocyst complex component SEC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC3 PE=1 SV=1 1177 1269 8.0E-06
sp|A2R7P5|NST1_ASPNC Stress response protein nst1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nst1 PE=3 SV=1 1099 1268 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7635
MDAQNAAESTLTRPARASPPQRPDTDRKPRSPTTVRVSSPSRDSRPKPHHDAAAHAAEHASSAARPDDNHPAWGD
RDSDAETIVLPGKHGHSPSKARKVRQEDKSESDGDAVRTKPNPDDAEHRAAIASSAACPPGNHHPADGAGKKRFS
ASAALEQDRRPRNKEAGSSGLSSAPASPPHHAQHQQQQQQQQQQQTQQNLHPHHHPHHHQHHPSQPHRRRRSDAA
PSSPSDLEQHSYQKTASKASLRDKLKPGERLLSHKRKAPKIESDDEADARKARRQRTTSANLDGPRPPKEARSTP
AKPPHDSRTRSISPQPRQHRRSISTQLPSQSSNGLNAKKKRLPPPLQPTDYHSDDSSAGGSPYPRSSKLRSLATP
AAADANTSPAKMAPHKKHLDAHGQTLLARACARGEYETAKQRLGERPEDLNVADYAGNTPLQIAAINGCEDIVKL
LIDAGCNLDCVNYDKDTPLLDAVDNGHLGVVRLLLEAGVNPRKANVNGEEPLDRVSEDTDHAEEIRAALIAARKR
AGERRRTSEDRQSHNDHHEVRDSHAPDSPRRSPAAAASMSTGRRSGTVRSTKTRNDLLYMPLDDKTLRQAAGRGD
EETVARILQVKEGYDDPESMIAAARGGHDLVIQLLLGLGGANADPAPTPSLPSEFATPILAAIGQENIKVIELLL
EQQGFDPTRRYKGETYYEIARRRQGTNWKEEEQMLKNAYDEFKRSHRDPIKTKSPAARRERERDREEKLSRKDDP
KDLTRAHKRNQSSPSREVEARKKSMGPKITSPREKKRPDSLLSRADDESHKRMLGRGKKDPSHISDREISPVFSH
KLQKAKRTESDITAMSSEGEAAKPRRKLVSKGELSRERDRQKRALKEPSSPRDSRNDDVPEKAKPSEKYHDRTKA
LKRDESKDHSPGDGATKRHRNSVTPDRPSDGDKEHPEGPVKRRRLDNEAHLEKRANRPASVDGRPRKSASSRDGP
TKHAAAGSRKDREDNHRDGQDQRGPSHHGATRVSGNNAVEKSIHVKSEDFDVPMIDIGQPGDQDQPDTPVVDQEE
EERLRKREMAEQEAKKEEVRKRLEAEEKKKRLEEEARKREEEEKARKAEEAKTRKAEEEKARKAEEEKARKAEEE
KARKAEEEKARKAEEEKARKAEEERKMREEEEARKRREAERERREAEEAARRQEEERKRLEEEKRKKEAEQKKKE
EEQRRREEEERLRKEQLEREAAEEARRQREEEERKERERRERAHREELERKRAAREAELKRLREEQERIRLDKLP
PLMRWLDLCPNPKTPAVADKFKRMLGPRYDTIRQEANGTAAGREQWVLNTHVALLLGEKDLDLSRYTAWERAPVT
SLAKQSLWRTEWVRYALVSDKLWDLGRQLPGYYGDEDPAAMTFETKRRLKQAAWERFLAMDMFFVKVSDLLYTVP
NIPHLRNIKLAVEYRELLEREEELVGWKTKQKWKNDPGVERFYGFAPRNRYFINGVFVGEDVPTLHQTSKTPFPE
ARVPRRGLLRVFPDDPDYERLCQEQGLEHLLEGPHTPSLPNGIDSSPTSQTTATPTKHRLVNGASGHSTHAAADN
AATTNGATTNGTDGP*
Coding >Hirsu2|7635
ATGGATGCGCAGAATGCCGCCGAGTCGACCCTGACGAGGCCTGCCCGCGCTTCTCCTCCCCAACGTCCCGACACG
GATCGCAAGCCCAGGTCGCCGACGACCGTCAGGGTCTCGTCGCCTTCACGGGACTCGAGACCCAAGCCTCACCAC
GATGCCGCTGCCCATGCTGCCGAGCATGCCTCGTCGGCAGCTCGCCCCGACGACAATCACCCCGCCTGGGGAGAC
CGCGACTCCGACGCCGAGACCATCGTCTTGCCCGGCAAGCATGGCCACTCGCCCTCCAAGGCCCGCAAGGTGCGC
CAGGAGGACAAGAGCGAGAGCGACGGTGATGCCGTTAGGACCAAGCCCAACCCCGACGACGCCGAACACAGGGCT
GCCATCGCCTCTTCCGCCGCTTGTCCACCCGGCAACCACCACCCGGCCGACGGCGCAGGCAAGAAGCGCTTCTCC
GCCTCGGCTGCCCTTGAACAGGACCGTCGTCCTCGCAACAAGGAGGCCGGCTCCAGCGGCTTGAGCTCGGCGCCG
GCCTCCCCGCCCCATCACGCGCAGCATCAGCAGCAGCAACAACAGCAGCAGCAGCAGCAGACACAGCAAAATCTT
CATCCCCACCACCATCCTCACCATCATCAACATCACCCGTCGCAGCCGCATCGTAGACGCCGCTCGGACGCCGCC
CCCTCCTCCCCGTCCGACTTGGAGCAGCACAGCTACCAAAAGACAGCATCCAAAGCATCTCTTCGTGACAAGCTC
AAGCCGGGCGAGCGGCTGCTGTCGCACAAGCGAAAAGCCCCCAAGATCGAGTCCGACGACGAGGCAGACGCTCGC
AAGGCCCGACGCCAGCGCACCACGAGCGCCAATCTCGACGGCCCGCGACCGCCCAAGGAGGCCAGGTCGACGCCT
GCCAAGCCCCCCCATGACTCCCGAACGCGATCCATCTCCCCCCAGCCGCGCCAGCACCGACGCTCCATCTCCACG
CAGCTCCCCTCGCAGTCGTCGAACGGCCTGAACGCGAAGAAGAAACGCCTGCCGCCGCCCCTGCAACCCACTGAC
TACCACTCGGACGACTCTTCCGCCGGCGGAAGCCCTTATCCGCGCAGTTCCAAGTTGCGTAGCCTCGCGACGCCG
GCCGCGGCCGACGCCAACACGTCACCGGCCAAGATGGCGCCTCACAAGAAGCACCTCGACGCGCATGGCCAGACG
CTCCTGGCGCGGGCCTGCGCCCGGGGCGAATACGAGACCGCCAAGCAGAGGCTTGGCGAGCGGCCCGAAGACTTG
AACGTGGCCGACTACGCCGGCAACACGCCGCTCCAAATCGCCGCCATTAACGGATGCGAGGACATCGTCAAGCTC
CTCATCGACGCCGGATGCAATCTGGACTGTGTCAATTACGATAAGGACACTCCACTGCTCGACGCTGTCGACAAC
GGCCACCTCGGCGTCGTCAGGCTCCTCTTGGAGGCGGGCGTCAACCCTCGCAAGGCCAACGTCAACGGCGAGGAG
CCTCTGGACCGCGTCAGCGAAGACACCGACCACGCCGAGGAAATCCGCGCCGCACTCATTGCCGCTCGCAAACGC
GCCGGCGAGCGCCGGCGAACCTCCGAGGACCGCCAGTCCCACAATGACCATCACGAGGTGCGTGACTCGCACGCC
CCGGACAGCCCTCGCCGCTCGCCGGCCGCGGCTGCGTCCATGTCCACCGGACGGCGAAGCGGAACCGTCCGGTCC
ACCAAGACGAGAAATGATCTGCTGTACATGCCCCTGGACGACAAGACCCTGCGCCAGGCTGCCGGCCGCGGCGAC
GAGGAGACGGTGGCACGTATTTTGCAGGTCAAGGAGGGCTACGACGACCCCGAATCCATGATTGCCGCGGCGCGC
GGCGGCCACGACTTGGTCATCCAGTTACTCTTGGGCCTGGGCGGAGCAAACGCCGATCCTGCGCCCACCCCATCC
CTCCCATCCGAGTTTGCCACACCCATACTGGCTGCCATCGGCCAGGAGAACATCAAGGTCATCGAGCTCCTCCTG
GAGCAGCAAGGCTTCGATCCGACAAGGAGATACAAGGGGGAAACGTATTACGAAATCGCCAGACGCCGCCAGGGC
ACGAATTGGAAGGAAGAGGAACAGATGTTGAAGAACGCGTACGACGAGTTCAAACGCTCGCACAGAGACCCCATC
AAGACCAAGTCGCCGGCTGCACGACGCGAGCGCGAAAGGGACCGGGAGGAGAAGCTGTCGAGGAAAGACGACCCG
AAAGATCTGACCAGGGCCCACAAGCGAAACCAGTCCAGTCCTTCTCGAGAAGTTGAGGCAAGGAAGAAGAGCATG
GGACCCAAGATCACCAGTCCGCGCGAAAAGAAGAGGCCCGACTCGCTCCTGAGCCGAGCCGACGACGAGTCTCAT
AAGCGAATGCTCGGGAGGGGCAAGAAGGACCCTTCCCATATTTCCGACCGCGAGATCTCTCCCGTCTTCTCCCAC
AAGCTCCAAAAGGCCAAGCGGACCGAGTCGGACATTACGGCCATGTCGTCTGAAGGCGAGGCGGCCAAACCCCGG
AGAAAGCTCGTATCCAAGGGTGAGCTGAGCCGAGAGCGCGACCGGCAGAAACGCGCGCTCAAGGAGCCTTCGAGC
CCCCGCGATTCGAGAAACGACGACGTGCCCGAGAAGGCCAAGCCGTCAGAGAAGTACCATGACAGAACCAAGGCC
CTGAAGCGAGACGAATCGAAGGACCACTCTCCCGGCGACGGAGCGACCAAGAGACACCGGAACAGCGTGACGCCC
GACCGTCCCAGCGATGGCGATAAGGAACACCCGGAGGGCCCGGTTAAGCGACGCCGGCTCGACAACGAGGCTCAT
CTGGAAAAGCGCGCGAATCGCCCTGCGTCTGTGGATGGGCGCCCTCGCAAATCCGCCTCATCTCGCGACGGGCCC
ACAAAGCATGCCGCTGCGGGAAGCAGGAAAGATCGCGAAGATAACCACAGGGATGGCCAAGACCAGCGAGGCCCA
TCGCACCACGGTGCCACACGGGTTAGCGGCAATAACGCGGTCGAGAAGTCTATCCACGTCAAGTCCGAAGACTTC
GACGTACCCATGATAGACATCGGACAACCGGGGGATCAAGACCAACCAGATACTCCAGTTGTTGACCAGGAGGAA
GAGGAGCGCTTGCGCAAGAGAGAAATGGCAGAACAAGAAGCAAAGAAAGAAGAAGTGCGGAAGCGACTGGAAGCC
GAGGAGAAGAAGAAGAGATTGGAGGAAGAGGCTCGCAAGCGAGAGGAGGAGGAGAAGGCCCGCAAGGCTGAGGAA
GCGAAGACCCGCAAGGCTGAGGAGGAGAAGGCCCGCAAGGCGGAAGAGGAGAAGGCGCGCAAGGCCGAGGAGGAG
AAGGCGCGCAAGGCCGAGGAGGAGAAGGCGCGCAAGGCCGAGGAGGAGAAGGCGCGCAAGGCCGAGGAAGAGAGG
AAGATGCGCGAGGAGGAGGAAGCCCGAAAGCGCCGGGAGGCGGAGCGCGAACGGCGCGAAGCCGAAGAGGCTGCC
CGGCGCCAGGAGGAGGAGAGGAAGCGCCTCGAAGAGGAAAAGAGAAAGAAGGAAGCGGAACAAAAGAAGAAGGAG
GAGGAGCAGAGGCGGCGCGAAGAGGAAGAGCGACTGCGCAAGGAACAGCTCGAACGCGAGGCCGCCGAGGAGGCC
CGACGTCAGCGCGAGGAGGAAGAGCGCAAAGAACGGGAGCGGCGTGAGCGTGCTCATCGCGAGGAGCTCGAGAGA
AAGCGCGCCGCCCGGGAGGCCGAGCTGAAGCGCCTCCGCGAGGAGCAAGAGCGGATTCGACTCGACAAGCTGCCG
CCGCTCATGCGCTGGCTCGACCTGTGTCCCAACCCAAAGACGCCCGCCGTCGCCGACAAATTCAAGCGTATGCTC
GGTCCGCGGTACGACACGATCCGCCAGGAAGCCAATGGCACGGCCGCGGGCCGCGAGCAATGGGTCCTCAACACA
CACGTTGCACTGCTCCTGGGCGAGAAGGATCTCGACCTGTCCAGATATACGGCCTGGGAACGAGCGCCAGTGACG
AGCCTCGCGAAGCAGTCGCTCTGGCGAACCGAATGGGTGCGCTATGCTCTAGTGTCCGACAAGCTTTGGGACCTC
GGACGGCAACTTCCCGGCTACTACGGCGACGAAGATCCGGCAGCCATGACTTTCGAGACAAAGCGGCGACTCAAG
CAGGCAGCATGGGAGCGGTTCCTCGCCATGGACATGTTCTTCGTGAAGGTGTCCGACCTCCTGTATACCGTGCCG
AATATACCACACCTGAGGAATATCAAGCTCGCGGTCGAGTATCGCGAGCTGTTGGAGAGGGAGGAGGAACTGGTT
GGGTGGAAGACCAAGCAGAAGTGGAAGAACGATCCGGGCGTTGAACGCTTCTACGGCTTCGCCCCTCGCAACAGG
TATTTCATCAACGGCGTTTTCGTCGGAGAAGACGTTCCGACGCTCCACCAGACCAGCAAAACTCCCTTCCCCGAG
GCGCGCGTGCCAAGGCGCGGCCTGCTGCGAGTTTTCCCAGACGACCCGGATTACGAGCGCCTCTGCCAGGAACAA
GGCCTGGAACACCTGCTCGAGGGCCCTCACACGCCCTCCCTACCGAACGGGATCGACTCGTCCCCGACCAGTCAG
ACTACAGCTACACCGACAAAGCACCGGCTCGTCAACGGCGCATCCGGGCACTCGACGCACGCGGCGGCCGACAAC
GCGGCGACGACCAATGGGGCGACAACGAACGGCACGGACGGTCCTTAG
Transcript >Hirsu2|7635
ATGGATGCGCAGAATGCCGCCGAGTCGACCCTGACGAGGCCTGCCCGCGCTTCTCCTCCCCAACGTCCCGACACG
GATCGCAAGCCCAGGTCGCCGACGACCGTCAGGGTCTCGTCGCCTTCACGGGACTCGAGACCCAAGCCTCACCAC
GATGCCGCTGCCCATGCTGCCGAGCATGCCTCGTCGGCAGCTCGCCCCGACGACAATCACCCCGCCTGGGGAGAC
CGCGACTCCGACGCCGAGACCATCGTCTTGCCCGGCAAGCATGGCCACTCGCCCTCCAAGGCCCGCAAGGTGCGC
CAGGAGGACAAGAGCGAGAGCGACGGTGATGCCGTTAGGACCAAGCCCAACCCCGACGACGCCGAACACAGGGCT
GCCATCGCCTCTTCCGCCGCTTGTCCACCCGGCAACCACCACCCGGCCGACGGCGCAGGCAAGAAGCGCTTCTCC
GCCTCGGCTGCCCTTGAACAGGACCGTCGTCCTCGCAACAAGGAGGCCGGCTCCAGCGGCTTGAGCTCGGCGCCG
GCCTCCCCGCCCCATCACGCGCAGCATCAGCAGCAGCAACAACAGCAGCAGCAGCAGCAGACACAGCAAAATCTT
CATCCCCACCACCATCCTCACCATCATCAACATCACCCGTCGCAGCCGCATCGTAGACGCCGCTCGGACGCCGCC
CCCTCCTCCCCGTCCGACTTGGAGCAGCACAGCTACCAAAAGACAGCATCCAAAGCATCTCTTCGTGACAAGCTC
AAGCCGGGCGAGCGGCTGCTGTCGCACAAGCGAAAAGCCCCCAAGATCGAGTCCGACGACGAGGCAGACGCTCGC
AAGGCCCGACGCCAGCGCACCACGAGCGCCAATCTCGACGGCCCGCGACCGCCCAAGGAGGCCAGGTCGACGCCT
GCCAAGCCCCCCCATGACTCCCGAACGCGATCCATCTCCCCCCAGCCGCGCCAGCACCGACGCTCCATCTCCACG
CAGCTCCCCTCGCAGTCGTCGAACGGCCTGAACGCGAAGAAGAAACGCCTGCCGCCGCCCCTGCAACCCACTGAC
TACCACTCGGACGACTCTTCCGCCGGCGGAAGCCCTTATCCGCGCAGTTCCAAGTTGCGTAGCCTCGCGACGCCG
GCCGCGGCCGACGCCAACACGTCACCGGCCAAGATGGCGCCTCACAAGAAGCACCTCGACGCGCATGGCCAGACG
CTCCTGGCGCGGGCCTGCGCCCGGGGCGAATACGAGACCGCCAAGCAGAGGCTTGGCGAGCGGCCCGAAGACTTG
AACGTGGCCGACTACGCCGGCAACACGCCGCTCCAAATCGCCGCCATTAACGGATGCGAGGACATCGTCAAGCTC
CTCATCGACGCCGGATGCAATCTGGACTGTGTCAATTACGATAAGGACACTCCACTGCTCGACGCTGTCGACAAC
GGCCACCTCGGCGTCGTCAGGCTCCTCTTGGAGGCGGGCGTCAACCCTCGCAAGGCCAACGTCAACGGCGAGGAG
CCTCTGGACCGCGTCAGCGAAGACACCGACCACGCCGAGGAAATCCGCGCCGCACTCATTGCCGCTCGCAAACGC
GCCGGCGAGCGCCGGCGAACCTCCGAGGACCGCCAGTCCCACAATGACCATCACGAGGTGCGTGACTCGCACGCC
CCGGACAGCCCTCGCCGCTCGCCGGCCGCGGCTGCGTCCATGTCCACCGGACGGCGAAGCGGAACCGTCCGGTCC
ACCAAGACGAGAAATGATCTGCTGTACATGCCCCTGGACGACAAGACCCTGCGCCAGGCTGCCGGCCGCGGCGAC
GAGGAGACGGTGGCACGTATTTTGCAGGTCAAGGAGGGCTACGACGACCCCGAATCCATGATTGCCGCGGCGCGC
GGCGGCCACGACTTGGTCATCCAGTTACTCTTGGGCCTGGGCGGAGCAAACGCCGATCCTGCGCCCACCCCATCC
CTCCCATCCGAGTTTGCCACACCCATACTGGCTGCCATCGGCCAGGAGAACATCAAGGTCATCGAGCTCCTCCTG
GAGCAGCAAGGCTTCGATCCGACAAGGAGATACAAGGGGGAAACGTATTACGAAATCGCCAGACGCCGCCAGGGC
ACGAATTGGAAGGAAGAGGAACAGATGTTGAAGAACGCGTACGACGAGTTCAAACGCTCGCACAGAGACCCCATC
AAGACCAAGTCGCCGGCTGCACGACGCGAGCGCGAAAGGGACCGGGAGGAGAAGCTGTCGAGGAAAGACGACCCG
AAAGATCTGACCAGGGCCCACAAGCGAAACCAGTCCAGTCCTTCTCGAGAAGTTGAGGCAAGGAAGAAGAGCATG
GGACCCAAGATCACCAGTCCGCGCGAAAAGAAGAGGCCCGACTCGCTCCTGAGCCGAGCCGACGACGAGTCTCAT
AAGCGAATGCTCGGGAGGGGCAAGAAGGACCCTTCCCATATTTCCGACCGCGAGATCTCTCCCGTCTTCTCCCAC
AAGCTCCAAAAGGCCAAGCGGACCGAGTCGGACATTACGGCCATGTCGTCTGAAGGCGAGGCGGCCAAACCCCGG
AGAAAGCTCGTATCCAAGGGTGAGCTGAGCCGAGAGCGCGACCGGCAGAAACGCGCGCTCAAGGAGCCTTCGAGC
CCCCGCGATTCGAGAAACGACGACGTGCCCGAGAAGGCCAAGCCGTCAGAGAAGTACCATGACAGAACCAAGGCC
CTGAAGCGAGACGAATCGAAGGACCACTCTCCCGGCGACGGAGCGACCAAGAGACACCGGAACAGCGTGACGCCC
GACCGTCCCAGCGATGGCGATAAGGAACACCCGGAGGGCCCGGTTAAGCGACGCCGGCTCGACAACGAGGCTCAT
CTGGAAAAGCGCGCGAATCGCCCTGCGTCTGTGGATGGGCGCCCTCGCAAATCCGCCTCATCTCGCGACGGGCCC
ACAAAGCATGCCGCTGCGGGAAGCAGGAAAGATCGCGAAGATAACCACAGGGATGGCCAAGACCAGCGAGGCCCA
TCGCACCACGGTGCCACACGGGTTAGCGGCAATAACGCGGTCGAGAAGTCTATCCACGTCAAGTCCGAAGACTTC
GACGTACCCATGATAGACATCGGACAACCGGGGGATCAAGACCAACCAGATACTCCAGTTGTTGACCAGGAGGAA
GAGGAGCGCTTGCGCAAGAGAGAAATGGCAGAACAAGAAGCAAAGAAAGAAGAAGTGCGGAAGCGACTGGAAGCC
GAGGAGAAGAAGAAGAGATTGGAGGAAGAGGCTCGCAAGCGAGAGGAGGAGGAGAAGGCCCGCAAGGCTGAGGAA
GCGAAGACCCGCAAGGCTGAGGAGGAGAAGGCCCGCAAGGCGGAAGAGGAGAAGGCGCGCAAGGCCGAGGAGGAG
AAGGCGCGCAAGGCCGAGGAGGAGAAGGCGCGCAAGGCCGAGGAGGAGAAGGCGCGCAAGGCCGAGGAAGAGAGG
AAGATGCGCGAGGAGGAGGAAGCCCGAAAGCGCCGGGAGGCGGAGCGCGAACGGCGCGAAGCCGAAGAGGCTGCC
CGGCGCCAGGAGGAGGAGAGGAAGCGCCTCGAAGAGGAAAAGAGAAAGAAGGAAGCGGAACAAAAGAAGAAGGAG
GAGGAGCAGAGGCGGCGCGAAGAGGAAGAGCGACTGCGCAAGGAACAGCTCGAACGCGAGGCCGCCGAGGAGGCC
CGACGTCAGCGCGAGGAGGAAGAGCGCAAAGAACGGGAGCGGCGTGAGCGTGCTCATCGCGAGGAGCTCGAGAGA
AAGCGCGCCGCCCGGGAGGCCGAGCTGAAGCGCCTCCGCGAGGAGCAAGAGCGGATTCGACTCGACAAGCTGCCG
CCGCTCATGCGCTGGCTCGACCTGTGTCCCAACCCAAAGACGCCCGCCGTCGCCGACAAATTCAAGCGTATGCTC
GGTCCGCGGTACGACACGATCCGCCAGGAAGCCAATGGCACGGCCGCGGGCCGCGAGCAATGGGTCCTCAACACA
CACGTTGCACTGCTCCTGGGCGAGAAGGATCTCGACCTGTCCAGATATACGGCCTGGGAACGAGCGCCAGTGACG
AGCCTCGCGAAGCAGTCGCTCTGGCGAACCGAATGGGTGCGCTATGCTCTAGTGTCCGACAAGCTTTGGGACCTC
GGACGGCAACTTCCCGGCTACTACGGCGACGAAGATCCGGCAGCCATGACTTTCGAGACAAAGCGGCGACTCAAG
CAGGCAGCATGGGAGCGGTTCCTCGCCATGGACATGTTCTTCGTGAAGGTGTCCGACCTCCTGTATACCGTGCCG
AATATACCACACCTGAGGAATATCAAGCTCGCGGTCGAGTATCGCGAGCTGTTGGAGAGGGAGGAGGAACTGGTT
GGGTGGAAGACCAAGCAGAAGTGGAAGAACGATCCGGGCGTTGAACGCTTCTACGGCTTCGCCCCTCGCAACAGG
TATTTCATCAACGGCGTTTTCGTCGGAGAAGACGTTCCGACGCTCCACCAGACCAGCAAAACTCCCTTCCCCGAG
GCGCGCGTGCCAAGGCGCGGCCTGCTGCGAGTTTTCCCAGACGACCCGGATTACGAGCGCCTCTGCCAGGAACAA
GGCCTGGAACACCTGCTCGAGGGCCCTCACACGCCCTCCCTACCGAACGGGATCGACTCGTCCCCGACCAGTCAG
ACTACAGCTACACCGACAAAGCACCGGCTCGTCAACGGCGCATCCGGGCACTCGACGCACGCGGCGGCCGACAAC
GCGGCGACGACCAATGGGGCGACAACGAACGGCACGGACGGTCCTTAG
Gene >Hirsu2|7635
ATGGATGCGCAGAATGCCGCCGAGTCGACCCTGACGAGGCCTGCCCGCGCTTCTCCTCCCCAACGTCCCGACACG
GATCGCAAGCCCAGGTCGCCGACGACCGTCAGGGTCTCGTCGCCTTCACGGGACTCGAGACCCAAGCCTCACCAC
GATGCCGCTGCCCATGCTGCCGAGCATGCCTCGTCGGCAGCTCGCCCCGACGACAATCACCCCGCCTGGGGAGAC
CGCGACTCCGACGCCGAGACCATCGTCTTGCCCGGCAAGCATGGCCACTCGCCCTCCAAGGCCCGCAAGGTGCGC
CAGGAGGACAAGAGCGAGAGCGACGGTGATGCCGTTAGGACCAAGCCCAACCCCGACGACGCCGAACACAGGGCT
GCCATCGCCTCTTCCGCCGCTTGTCCACCCGGCAACCACCACCCGGCCGACGGCGCAGGCAAGAAGCGCTTCTCC
GCCTCGGCTGCCCTTGAACAGGACCGTCGTCCTCGCAACAAGGAGGCCGGCTCCAGCGGCTTGAGCTCGGCGCCG
GCCTCCCCGCCCCATCACGCGCAGCATCAGCAGCAGCAACAACAGCAGCAGCAGCAGCAGACACAGCAAAATCTT
CATCCCCACCACCATCCTCACCATCATCAACATCACCCGTCGCAGCCGCATCGTAGACGCCGCTCGGACGCCGCC
CCCTCCTCCCCGTCCGACTTGGAGCAGCACAGCTACCAAAAGACAGCATCCAAAGCATCTCTTCGTGACAAGCTC
AAGCCGGGCGAGCGGCTGCTGTCGCACAAGCGAAAAGCCCCCAAGATCGAGTCCGACGACGAGGCAGACGCTCGC
AAGGCCCGACGCCAGCGCACCACGAGCGCCAATCTCGACGGCCCGCGACCGCCCAAGGAGGCCAGGTCGACGCCT
GCCAAGCCCCCCCATGACTCCCGAACGCGATCCATCTCCCCCCAGCCGCGCCAGCACCGACGCTCCATCTCCACG
CAGCTCCCCTCGCAGTCGTCGAACGGCCTGAACGCGAAGAAGAAACGCCTGCCGCCGCCCCTGCAACCCACTGAC
TACCACTCGGACGACTCTTCCGCCGGCGGAAGCCCTTATCCGCGCAGTTCCAAGTTGCGTAGCCTCGCGACGCCG
GCCGCGGCCGACGCCAACACGTCACCGGCCAAGATGGCGCCTCACAAGAAGCACCTCGACGCGCATGGCCAGACG
CTCCTGGCGCGGGCCTGCGCCCGGGGCGAATACGAGACCGCCAAGCAGAGGCTTGGCGAGCGGCCCGAAGACTTG
AACGTGGCCGACTACGCCGGCAACACGCCGCTCCAAATCGCCGCCATTAACGGATGCGAGGACATCGTCAAGCTC
CTCATCGACGCCGGATGCAATCTGGACTGTGTCAATTACGATAAGGACACTCCACTGCTCGACGCTGTCGACAAC
GGCCACCTCGGCGTCGTCAGGCTCCTCTTGGAGGCGGGCGTCAACCCTCGCAAGGCCAACGTCAACGGCGAGGAG
CCTCTGGACCGCGTCAGCGAAGACACCGACCACGCCGAGGAAATCCGCGCCGCACTCATTGCCGCTCGCAAACGC
GCCGGCGAGCGCCGGCGAACCTCCGAGGACCGCCAGTCCCACAATGACCATCACGAGGTGCGTGACTCGCACGCC
CCGGACAGCCCTCGCCGCTCGCCGGCCGCGGCTGCGTCCATGTCCACCGGACGGCGAAGCGGAACCGTCCGGTCC
ACCAAGACGAGAAATGATCTGCTGTACATGCCCCTGGACGACAAGACCCTGCGCCAGGCTGCCGGCCGCGGCGAC
GAGGAGACGGTGGCACGTATTTTGCAGGTCAAGGAGGGCTACGACGACCCCGAATCCATGATTGCCGCGGCGCGC
GGCGGCCACGACTTGGTCATCCAGTTACTCTTGGGCCTGGGCGGAGCAAACGCCGATCCTGCGCCCACCCCATCC
CTCCCATCCGAGTTTGCCACACCCATACTGGCTGCCATCGGCCAGGAGAACATCAAGGTCATCGAGCTCCTCCTG
GAGCAGCAAGGCTTCGATCCGACAAGGAGATACAAGGGGGAAACGTATTACGAAATCGCCAGACGCCGCCAGGGC
ACGAATTGGAAGGAAGAGGAACAGATGTTGAAGAACGCGTACGACGAGTTCAAACGCTCGCACAGAGACCCCATC
AAGACCAAGTCGCCGGCTGCACGACGCGAGCGCGAAAGGGACCGGGAGGAGAAGCTGTCGAGGAAAGACGACCCG
AAAGATCTGACCAGGGCCCACAAGCGAAACCAGTCCAGTCCTTCTCGAGAAGTTGAGGCAAGGAAGAAGAGCATG
GGACCCAAGATCACCAGTCCGCGCGAAAAGAAGAGGCCCGACTCGCTCCTGAGCCGAGCCGACGACGAGTCTCAT
AAGCGAATGCTCGGGAGGGGCAAGAAGGACCCTTCCCATATTTCCGACCGCGAGATCTCTCCCGTCTTCTCCCAC
AAGCTCCAAAAGGCCAAGCGGACCGAGTCGGACATTACGGCCATGTCGTCTGAAGGCGAGGCGGCCAAACCCCGG
AGAAAGCTCGTATCCAAGGGTGAGCTGAGCCGAGAGCGCGACCGGCAGAAACGCGCGCTCAAGGAGCCTTCGAGC
CCCCGCGATTCGAGAAACGACGACGTGCCCGAGAAGGCCAAGCCGTCAGAGAAGTACCATGACAGAACCAAGGCC
CTGAAGCGAGACGAATCGAAGGACCACTCTCCCGGCGACGGAGCGACCAAGAGACACCGGAACAGCGTGACGCCC
GACCGTCCCAGCGATGGCGATAAGGAACACCCGGAGGGCCCGGTTAAGCGACGCCGGCTCGACAACGAGGCTCAT
CTGGAAAAGCGCGCGAATCGCCCTGCGTCTGTGGATGGGCGCCCTCGCAAATCCGCCTCATCTCGCGACGGGCCC
ACAAAGCATGCCGCTGCGGGAAGCAGGAAAGATCGCGAAGATAACCACAGGGATGGCCAAGACCAGCGAGGCCCA
TCGCACCACGGTGCCACACGGGTTAGCGGCAATAACGCGGTCGAGAAGTCTATCCACGTCAAGTCCGAAGACTTC
GACGTACCCATGATAGACATCGGACAACCGGGGGATCAAGACCAACCAGATACTCCAGTTGTTGACCAGGAGGAA
GAGGAGCGCTTGCGCAAGAGAGAAATGGCAGAACAAGAAGCAAAGAAAGAAGAAGTGCGGAAGCGACTGGAAGCC
GAGGAGAAGAAGAAGAGATTGGAGGAAGAGGCTCGCAAGCGAGAGGAGGAGGAGAAGGCCCGCAAGGCTGAGGAA
GCGAAGACCCGCAAGGCTGAGGAGGAGAAGGCCCGCAAGGCGGAAGAGGAGAAGGCGCGCAAGGCCGAGGAGGAG
AAGGCGCGCAAGGCCGAGGAGGAGAAGGCGCGCAAGGCCGAGGAGGAGAAGGCGCGCAAGGCCGAGGAAGAGAGG
AAGATGCGCGAGGAGGAGGAAGCCCGAAAGCGCCGGGAGGCGGAGCGCGAACGGCGCGAAGCCGAAGAGGCTGCC
CGGCGCCAGGAGGAGGAGAGGAAGCGCCTCGAAGAGGAAAAGAGAAAGAAGGAAGCGGAACAAAAGAAGAAGGAG
GAGGAGCAGAGGCGGCGCGAAGAGGAAGAGCGACTGCGCAAGGAACAGCTCGAACGCGAGGCCGCCGAGGAGGCC
CGACGTCAGCGCGAGGAGGAAGAGCGCAAAGAACGGGAGCGGCGTGAGCGTGCTCATCGCGAGGAGCTCGAGAGA
AAGCGCGCCGCCCGGGAGGCCGAGCTGAAGCGCCTCCGCGAGGAGCAAGAGCGGATTCGACTCGACAAGCTGCCG
CCGCTCATGCGCTGGCTCGACCTGTGTCCCAACCCAAAGACGCCCGCCGTCGCCGACAAATTCAAGCGTATGCTC
GGTCCGCGGTACGACACGATCCGCCAGGAAGCCAATGGCACGGCCGCGGGCCGCGAGCAATGGGTCCTCAACACA
CACGTTGCACTGCTCCTGGGCGAGAAGGATCTCGACCTGTCCAGATGTACGCCACTCACCAAACCAACCCCCGCC
GTCGCGGCTGTCGAGAGCTGACTGGTCCTTTTTTTTTCTCTTCAGATACGGCCTGGGAACGAGCGCCAGTGACGA
GCCTCGCGAAGCAGTCGCTCTGGCGAACCGAATGGGTGCGCTATGCTCTAGTGTCCGACAAGCTTTGGGACCTCG
GACGGCAACTTCCCGGCTACTACGGCGACGAAGATCCGGCAGCCATGACTTTCGAGACAAAGCGGCGACTCAAGC
AGGCAGCATGGGAGCGGTTCCTCGCCATGGACATGTTCTTCGTGAAGGTATGTGCAGACGTCGAGCGTCACGGCC
AGCCGACTCGTCCAAGGCGCTGACAGGGCCTCGCAGGTGTCCGACCTCCTGTATACCGTGCCGAATATACCACAC
CTGAGGAATATCAAGCTCGCGGTCGAGTATCGCGAGCTGTTGGAGAGGGAGGAGGAACTGGTTGGGTGGAAGACC
AAGCAGAAGTGGAAGAACGATCCGGGCGTTGAACGCTTCTACGGCTTCGCCCCTCGCAACAGGTATTTCATCAAC
GGCGTTTTCGTCGGAGAAGACGTTCCGACGCTCCACCAGACCAGCAAAACTCCCTTCCCCGAGGCGCGCGTGCCA
AGGCGCGGCCTGCTGCGAGTTTTCCCAGACGACCCGGATTACGAGCGCCTCTGCCAGGAACAAGGCCTGGAACAC
CTGCTCGAGGGCCCTCACACGCCCTCCCTACCGAACGGGATCGACTCGTCCCCGACCAGTCAGACTACAGCTACA
CCGACAAAGCACCGGCTCGTCAACGGCGCATCCGGGCACTCGACGCACGCGGCGGCCGACAACGCGGCGACGACC
AATGGGGCGACAACGAACGGCACGGACGGTCCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail