Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7633
Gene name
LocationContig_455:16..701
Strand+
Gene length (bp)685
Transcript length (bp)633
Coding sequence length (bp)633
Protein length (aa) 211

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02544 Steroid_dh 3-oxo-5-alpha-steroid 4-dehydrogenase 2.6E-14 76 210

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40526|DFG10_YEAST Polyprenol reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DFG10 PE=1 SV=1 37 209 3.0E-16
sp|Q0P4J9|PORED_XENTR Polyprenol reductase OS=Xenopus tropicalis GN=srd5a3 PE=2 SV=1 13 210 2.0E-12
sp|Q7F0Q2|POED2_ORYSJ Polyprenol reductase 2 OS=Oryza sativa subsp. japonica GN=Os07g0493400 PE=2 SV=1 26 209 6.0E-12
sp|B8B6G5|POED2_ORYSI Polyprenol reductase 2 OS=Oryza sativa subsp. indica GN=OsI_26070 PE=3 SV=2 26 209 8.0E-12
sp|Q8AVI9|PORED_XENLA Polyprenol reductase OS=Xenopus laevis GN=srd5a3 PE=2 SV=1 27 210 6.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40526|DFG10_YEAST Polyprenol reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DFG10 PE=1 SV=1 37 209 3.0E-16
sp|Q0P4J9|PORED_XENTR Polyprenol reductase OS=Xenopus tropicalis GN=srd5a3 PE=2 SV=1 13 210 2.0E-12
sp|Q7F0Q2|POED2_ORYSJ Polyprenol reductase 2 OS=Oryza sativa subsp. japonica GN=Os07g0493400 PE=2 SV=1 26 209 6.0E-12
sp|B8B6G5|POED2_ORYSI Polyprenol reductase 2 OS=Oryza sativa subsp. indica GN=OsI_26070 PE=3 SV=2 26 209 8.0E-12
sp|Q8AVI9|PORED_XENLA Polyprenol reductase OS=Xenopus laevis GN=srd5a3 PE=2 SV=1 27 210 6.0E-11
sp|O14264|YFP9_SCHPO Uncharacterized protein C7D4.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC7D4.09c PE=3 SV=3 26 210 1.0E-10
sp|Q7XUH5|POED1_ORYSJ Polyprenol reductase 1 OS=Oryza sativa subsp. japonica GN=Os04g0576800 PE=2 SV=2 26 209 1.0E-10
sp|A2XWN6|POED1_ORYSI Polyprenol reductase 1 OS=Oryza sativa subsp. indica GN=OsI_17065 PE=3 SV=1 26 209 1.0E-10
sp|A8X8R3|PORED_CAEBR Polyprenol reductase OS=Caenorhabditis briggsae GN=CBG09584 PE=3 SV=1 17 209 2.0E-07
sp|Q9SI62|POED2_ARATH Polyprenol reductase 2 OS=Arabidopsis thaliana GN=At2g16530 PE=1 SV=2 105 210 3.0E-07
sp|Q9H8P0|PORED_HUMAN Polyprenol reductase OS=Homo sapiens GN=SRD5A3 PE=1 SV=1 1 210 4.0E-06
sp|D2HBV9|PORED_AILME Polyprenol reductase OS=Ailuropoda melanoleuca GN=SRD5A3 PE=3 SV=1 28 210 5.0E-06
sp|Q17428|PORED_CAEEL Polyprenol reductase OS=Caenorhabditis elegans GN=B0024.13 PE=3 SV=2 40 210 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0006629 lipid metabolic process Yes
GO:0016491 oxidoreductase activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 57 79 22
2 161 183 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7633
MTALARAQLRADEAAAAPPTSVELGRVFVAFAMLAVQGTRRLYECRFVLRPSKSPMLVPHWLLGIAFYTFMGLAV
WIHGSGAILAAWTSGRPAIVVTPRVPSAVALFLMASLKQNECHCYLAGLKKYTLPSEGLFRHLVCPHYSCECVIY
LAIAFVAAPPGSLFNPSVLCGLVFVAGNLGVTARTTKQWYARKFGADNVAGRWAMIPFVF*
Coding >Hirsu2|7633
ATGACGGCGCTGGCCCGGGCCCAGCTCCGCGCCGACGAGGCGGCCGCCGCGCCGCCGACCTCGGTCGAGCTGGGC
CGCGTCTTCGTCGCCTTCGCCATGCTCGCCGTGCAGGGCACCAGGAGGCTGTACGAATGCCGCTTCGTCCTCCGG
CCGAGCAAGTCGCCCATGCTGGTCCCCCACTGGCTCCTGGGCATCGCCTTCTACACCTTCATGGGCCTGGCCGTC
TGGATCCACGGCTCCGGCGCCATTCTCGCGGCCTGGACCTCGGGCCGGCCCGCCATTGTCGTGACGCCGCGGGTG
CCCTCGGCTGTGGCCCTCTTCCTCATGGCGAGCCTGAAGCAGAACGAGTGCCATTGCTACCTCGCCGGCCTGAAG
AAGTATACGCTGCCTAGCGAGGGCTTGTTTCGGCACCTCGTCTGCCCGCACTACAGTTGCGAGTGCGTCATCTAC
CTCGCCATCGCCTTCGTCGCGGCGCCGCCCGGCAGCCTGTTCAACCCGTCCGTGCTGTGCGGCTTGGTATTCGTG
GCGGGCAACCTGGGTGTTACGGCGCGTACCACCAAGCAGTGGTACGCCCGCAAGTTCGGTGCCGACAACGTGGCT
GGCAGGTGGGCCATGATCCCCTTCGTCTTCTAG
Transcript >Hirsu2|7633
ATGACGGCGCTGGCCCGGGCCCAGCTCCGCGCCGACGAGGCGGCCGCCGCGCCGCCGACCTCGGTCGAGCTGGGC
CGCGTCTTCGTCGCCTTCGCCATGCTCGCCGTGCAGGGCACCAGGAGGCTGTACGAATGCCGCTTCGTCCTCCGG
CCGAGCAAGTCGCCCATGCTGGTCCCCCACTGGCTCCTGGGCATCGCCTTCTACACCTTCATGGGCCTGGCCGTC
TGGATCCACGGCTCCGGCGCCATTCTCGCGGCCTGGACCTCGGGCCGGCCCGCCATTGTCGTGACGCCGCGGGTG
CCCTCGGCTGTGGCCCTCTTCCTCATGGCGAGCCTGAAGCAGAACGAGTGCCATTGCTACCTCGCCGGCCTGAAG
AAGTATACGCTGCCTAGCGAGGGCTTGTTTCGGCACCTCGTCTGCCCGCACTACAGTTGCGAGTGCGTCATCTAC
CTCGCCATCGCCTTCGTCGCGGCGCCGCCCGGCAGCCTGTTCAACCCGTCCGTGCTGTGCGGCTTGGTATTCGTG
GCGGGCAACCTGGGTGTTACGGCGCGTACCACCAAGCAGTGGTACGCCCGCAAGTTCGGTGCCGACAACGTGGCT
GGCAGGTGGGCCATGATCCCCTTCGTCTTCTAG
Gene >Hirsu2|7633
ATGACGGCGCTGGCCCGGGCCCAGCTCCGCGCCGACGAGGCGGCCGCCGCGCCGCCGACCTCGGTCGAGCTGGGC
CGCGTCTTCGTCGCCTTCGCCATGCTCGCCGTGCAGGGCACCAGGAGGCTGTACGAATGCCGCTTCGTCCTCCGG
CCGAGCAAGTCGCCCATGCTGGTCCCCCACTGGCTCCTGGGCATCGCCTTCTACACCTTCATGGGCCTGGCCGTC
TGGATCCACGGCTCCGGTCCGTCTGCCTGCGCTCCCGTCTTCTGTGCTGGTGCTGATGCGTTTGCTAGGCGCCAT
TCTCGCGGCCTGGACCTCGGGCCGGCCCGCCATTGTCGTGACGCCGCGGGTGCCCTCGGCTGTGGCCCTCTTCCT
CATGGCGAGCCTGAAGCAGAACGAGTGCCATTGCTACCTCGCCGGCCTGAAGAAGTATACGCTGCCTAGCGAGGG
CTTGTTTCGGCACCTCGTCTGCCCGCACTACAGTTGCGAGTGCGTCATCTACCTCGCCATCGCCTTCGTCGCGGC
GCCGCCCGGCAGCCTGTTCAACCCGTCCGTGCTGTGCGGCTTGGTATTCGTGGCGGGCAACCTGGGTGTTACGGC
GCGTACCACCAAGCAGTGGTACGCCCGCAAGTTCGGTGCCGACAACGTGGCTGGCAGGTGGGCCATGATCCCCTT
CGTCTTCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail