Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7625
Gene name
LocationContig_453:14595..17929
Strand+
Gene length (bp)3334
Transcript length (bp)3165
Coding sequence length (bp)3165
Protein length (aa) 1055

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11915 DUF3433 Protein of unknown function (DUF3433) 6.7E-11 487 573

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

Domain # Start End Length
1 312 334 22
2 445 462 17
3 551 573 22
4 915 937 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7625
MTEAYASARFGRSMPPFTTEDFALLPFYVDQQAVREPTKSNITAKTTSLFAKLICTPAAVGKPTFNDARWGTWEI
YPVNGSRQNSGYYWVDYFGVDAASGYWLPPLKSKCPPNSSSLAHSAMVISMLQPPRKGGLTVSQVVPRTCERRYY
KQEVMATVDAFDFKVYPESLRSISEPSQLLQFDSQSFEQRLLLDGFGMEFGNEDGDNRSASVDEIEELIATYEPA
AYTSAWALIATRASRMRLFADTLHGQNLPAEAKVDREALEKALHRAHRYLFSYTVSSTLANQTEHELGNRTAMID
TLAYGILVSPYFATAAESLLLLIAIIASTLLYFCCKAQCYLLWNPNSISRLCCICSASPGIINLYRSLATTNEKI
VESLLQDSLFRLSHCGCTYRCQLWLEEVKPSTAMRPGDIGTGQARLSDMVNARAHHYKPAIPFEVTRKAGILLII
ILLGILATFATLKWQEVSQAGLRRPSEAPEVLLVLEKALPTAFATLLEAFWSLLNLQLCVLQPFREPCAGTSRIG
TSIATTYSAVPPQLTIWRALKARHFLLVALCLTSLGAKALFIGLGGLFNENDTTAWRTQAFEPVLSPSLNISALG
STIREMLRTAQHTERQQSKFSLDTTAQNSEIVLYAHFRYGTRLPAWVSSRYFFQPHRPTGQESASTDVYAFNTRG
FGLNANCTPCLLHPLLSQNDRTSLDAIGRCPETTVHATPWTEDGKCVTELESELALDIKCGTAFMIGWDVSPGEQ
TGLTGAAAINHHAVCCQPVLQTAMFDVTVDSAGFIKSADRTTALEHRIDLPSHNETNMHMMLRAFINYALPHAWV
NEYGFYFQCPSELFATLFGGSTGRGRQFLETLHPLPDPVKLIPLVEDFYSKYFAILLWSRQEIFQRGRASDSILG
SRLVPERRIFMDQYALGIVTAILLIDIAVAIVFYSSISAIRILPHMPNTIGSLIAYIAPSRLVARWRSRSIDENT
AIRFGRYPVGLGSERHIGIEMEQYVLPVDAYCLEKRGTTWRAWLSKLSWPSWRTIRTRPRQPEESGGQPGGQPAS
LNTV*
Coding >Hirsu2|7625
ATGACTGAAGCTTACGCCTCCGCGCGATTCGGCCGGTCCATGCCACCGTTCACTACGGAGGACTTTGCACTCCTA
CCGTTCTACGTGGATCAACAAGCCGTACGAGAACCGACAAAGTCGAACATCACTGCCAAAACCACCAGCCTTTTC
GCTAAACTCATCTGTACACCAGCCGCTGTCGGCAAGCCGACGTTCAACGACGCCAGATGGGGAACATGGGAAATT
TACCCGGTCAATGGCTCCCGTCAAAATAGTGGATACTACTGGGTTGATTATTTCGGAGTCGACGCGGCTTCAGGC
TATTGGTTGCCTCCGCTTAAAAGTAAGTGTCCACCAAACTCGTCGTCCCTGGCCCACTCAGCAATGGTCATATCG
ATGCTACAGCCCCCTCGCAAAGGGGGATTGACTGTAAGCCAGGTGGTGCCTCGAACGTGTGAGAGACGTTACTAC
AAACAGGAGGTCATGGCGACAGTGGACGCTTTCGACTTTAAAGTATACCCCGAGTCTCTCCGGTCTATCTCCGAA
CCGAGTCAACTGCTCCAGTTCGACAGTCAAAGTTTCGAACAGCGACTGCTCCTGGACGGCTTTGGAATGGAATTT
GGCAATGAGGATGGGGACAATCGATCTGCCTCGGTAGACGAGATCGAGGAATTAATTGCAACCTATGAACCAGCA
GCCTATACTTCAGCATGGGCGCTTATCGCGACTCGGGCGTCGAGAATGCGTCTTTTTGCCGATACACTGCACGGA
CAAAACCTTCCTGCAGAGGCAAAGGTCGACCGAGAGGCTCTCGAGAAAGCATTACATCGTGCGCATAGGTACCTT
TTCTCGTACACAGTCTCGTCAACGCTCGCAAACCAGACCGAACATGAACTCGGCAATCGAACTGCAATGATAGAC
ACTCTGGCGTACGGAATTCTCGTTAGCCCATACTTCGCGACTGCGGCAGAATCTCTGCTCCTACTTATCGCTATC
ATAGCATCAACCCTTTTATACTTCTGTTGCAAAGCGCAATGCTACCTCCTATGGAACCCGAACTCCATTTCGCGA
CTCTGCTGTATCTGCAGTGCAAGCCCTGGAATTATCAACTTATATAGAAGTTTAGCAACTACTAACGAAAAGATA
GTCGAGTCATTACTGCAAGATAGCTTATTTCGGCTTTCACATTGCGGGTGCACCTACCGATGTCAACTTTGGCTC
GAAGAGGTCAAGCCTAGTACTGCTATGCGACCTGGAGATATAGGAACCGGACAGGCGAGGCTATCCGATATGGTG
AATGCGCGAGCACACCATTACAAACCGGCAATACCCTTCGAGGTTACTCGCAAGGCAGGCATCTTGTTAATAATT
ATCTTGCTCGGCATACTCGCGACATTTGCTACACTCAAGTGGCAGGAAGTCAGTCAAGCCGGCCTCCGTCGACCA
TCGGAAGCCCCCGAAGTCTTGCTAGTCCTAGAGAAGGCTTTGCCCACGGCCTTTGCGACATTGCTTGAGGCTTTC
TGGTCTCTCTTGAACCTGCAACTCTGCGTCCTTCAGCCATTCCGGGAGCCATGCGCAGGTACAAGCCGCATAGGC
ACAAGTATTGCTACGACATACTCAGCCGTCCCTCCGCAATTAACTATTTGGAGGGCTTTAAAGGCTCGCCACTTT
CTCCTAGTAGCTCTTTGCTTAACAAGTTTAGGAGCGAAGGCTCTGTTTATTGGCCTTGGCGGGCTGTTTAACGAG
AACGATACAACTGCTTGGCGCACACAAGCGTTCGAGCCTGTTCTGTCCCCATCATTAAATATTTCCGCACTCGGT
TCAACCATTCGGGAAATGTTAAGGACCGCCCAACATACCGAACGGCAGCAATCCAAATTTTCTCTGGACACCACT
GCTCAGAATTCCGAGATAGTTCTATATGCACATTTCAGATATGGGACACGGCTGCCTGCTTGGGTATCGTCGCGC
TATTTCTTCCAGCCGCATCGACCAACGGGACAGGAAAGTGCATCGACTGACGTTTACGCCTTCAACACTCGAGGG
TTCGGCCTGAACGCAAACTGTACTCCCTGCCTTCTGCATCCCCTCTTAAGCCAAAACGATAGGACCTCTTTAGAT
GCCATTGGCCGGTGTCCGGAAACGACCGTGCATGCAACTCCATGGACTGAAGACGGTAAATGTGTGACTGAATTG
GAGTCAGAGCTAGCATTAGACATAAAATGCGGCACGGCGTTTATGATAGGGTGGGATGTCTCCCCGGGCGAGCAA
ACTGGACTCACTGGAGCTGCTGCTATCAATCATCATGCCGTATGCTGCCAACCGGTGCTGCAAACAGCCATGTTC
GATGTTACCGTCGACTCGGCAGGATTTATCAAGTCGGCCGACAGGACAACAGCGCTTGAACATCGAATCGACTTG
CCGTCCCACAACGAAACGAACATGCATATGATGCTGAGAGCTTTCATCAACTACGCATTACCCCATGCTTGGGTA
AATGAATACGGCTTTTATTTCCAATGTCCCTCGGAGCTTTTCGCGACTTTGTTTGGTGGAAGCACTGGAAGGGGA
AGGCAATTCCTCGAGACGCTTCATCCACTCCCGGACCCTGTCAAGCTTATACCGCTGGTAGAGGATTTCTATTCG
AAATATTTCGCCATCCTTCTCTGGAGTCGACAGGAGATATTCCAACGAGGTCGAGCCAGCGATAGTATCTTAGGG
AGCAGGCTTGTACCGGAGAGGAGAATCTTTATGGACCAATACGCCTTGGGCATAGTGACTGCGATTTTACTCATC
GATATCGCGGTCGCAATCGTCTTCTACTCGTCCATATCGGCAATCCGGATTCTGCCGCATATGCCGAACACGATT
GGGTCCCTGATTGCGTATATAGCCCCGAGCCGTCTCGTGGCCAGATGGAGGTCGAGATCGATCGACGAGAATACT
GCTATCCGCTTCGGCCGCTATCCCGTCGGGCTTGGTAGCGAACGGCATATCGGCATCGAGATGGAACAATATGTG
CTGCCCGTCGACGCTTACTGCCTGGAGAAAAGAGGGACGACGTGGAGGGCTTGGCTTTCGAAGCTGTCATGGCCG
TCATGGCGTACGATTCGGACTCGACCGCGACAACCGGAGGAGTCGGGAGGTCAGCCGGGCGGTCAGCCCGCCAGT
TTGAATACCGTCTAG
Transcript >Hirsu2|7625
ATGACTGAAGCTTACGCCTCCGCGCGATTCGGCCGGTCCATGCCACCGTTCACTACGGAGGACTTTGCACTCCTA
CCGTTCTACGTGGATCAACAAGCCGTACGAGAACCGACAAAGTCGAACATCACTGCCAAAACCACCAGCCTTTTC
GCTAAACTCATCTGTACACCAGCCGCTGTCGGCAAGCCGACGTTCAACGACGCCAGATGGGGAACATGGGAAATT
TACCCGGTCAATGGCTCCCGTCAAAATAGTGGATACTACTGGGTTGATTATTTCGGAGTCGACGCGGCTTCAGGC
TATTGGTTGCCTCCGCTTAAAAGTAAGTGTCCACCAAACTCGTCGTCCCTGGCCCACTCAGCAATGGTCATATCG
ATGCTACAGCCCCCTCGCAAAGGGGGATTGACTGTAAGCCAGGTGGTGCCTCGAACGTGTGAGAGACGTTACTAC
AAACAGGAGGTCATGGCGACAGTGGACGCTTTCGACTTTAAAGTATACCCCGAGTCTCTCCGGTCTATCTCCGAA
CCGAGTCAACTGCTCCAGTTCGACAGTCAAAGTTTCGAACAGCGACTGCTCCTGGACGGCTTTGGAATGGAATTT
GGCAATGAGGATGGGGACAATCGATCTGCCTCGGTAGACGAGATCGAGGAATTAATTGCAACCTATGAACCAGCA
GCCTATACTTCAGCATGGGCGCTTATCGCGACTCGGGCGTCGAGAATGCGTCTTTTTGCCGATACACTGCACGGA
CAAAACCTTCCTGCAGAGGCAAAGGTCGACCGAGAGGCTCTCGAGAAAGCATTACATCGTGCGCATAGGTACCTT
TTCTCGTACACAGTCTCGTCAACGCTCGCAAACCAGACCGAACATGAACTCGGCAATCGAACTGCAATGATAGAC
ACTCTGGCGTACGGAATTCTCGTTAGCCCATACTTCGCGACTGCGGCAGAATCTCTGCTCCTACTTATCGCTATC
ATAGCATCAACCCTTTTATACTTCTGTTGCAAAGCGCAATGCTACCTCCTATGGAACCCGAACTCCATTTCGCGA
CTCTGCTGTATCTGCAGTGCAAGCCCTGGAATTATCAACTTATATAGAAGTTTAGCAACTACTAACGAAAAGATA
GTCGAGTCATTACTGCAAGATAGCTTATTTCGGCTTTCACATTGCGGGTGCACCTACCGATGTCAACTTTGGCTC
GAAGAGGTCAAGCCTAGTACTGCTATGCGACCTGGAGATATAGGAACCGGACAGGCGAGGCTATCCGATATGGTG
AATGCGCGAGCACACCATTACAAACCGGCAATACCCTTCGAGGTTACTCGCAAGGCAGGCATCTTGTTAATAATT
ATCTTGCTCGGCATACTCGCGACATTTGCTACACTCAAGTGGCAGGAAGTCAGTCAAGCCGGCCTCCGTCGACCA
TCGGAAGCCCCCGAAGTCTTGCTAGTCCTAGAGAAGGCTTTGCCCACGGCCTTTGCGACATTGCTTGAGGCTTTC
TGGTCTCTCTTGAACCTGCAACTCTGCGTCCTTCAGCCATTCCGGGAGCCATGCGCAGGTACAAGCCGCATAGGC
ACAAGTATTGCTACGACATACTCAGCCGTCCCTCCGCAATTAACTATTTGGAGGGCTTTAAAGGCTCGCCACTTT
CTCCTAGTAGCTCTTTGCTTAACAAGTTTAGGAGCGAAGGCTCTGTTTATTGGCCTTGGCGGGCTGTTTAACGAG
AACGATACAACTGCTTGGCGCACACAAGCGTTCGAGCCTGTTCTGTCCCCATCATTAAATATTTCCGCACTCGGT
TCAACCATTCGGGAAATGTTAAGGACCGCCCAACATACCGAACGGCAGCAATCCAAATTTTCTCTGGACACCACT
GCTCAGAATTCCGAGATAGTTCTATATGCACATTTCAGATATGGGACACGGCTGCCTGCTTGGGTATCGTCGCGC
TATTTCTTCCAGCCGCATCGACCAACGGGACAGGAAAGTGCATCGACTGACGTTTACGCCTTCAACACTCGAGGG
TTCGGCCTGAACGCAAACTGTACTCCCTGCCTTCTGCATCCCCTCTTAAGCCAAAACGATAGGACCTCTTTAGAT
GCCATTGGCCGGTGTCCGGAAACGACCGTGCATGCAACTCCATGGACTGAAGACGGTAAATGTGTGACTGAATTG
GAGTCAGAGCTAGCATTAGACATAAAATGCGGCACGGCGTTTATGATAGGGTGGGATGTCTCCCCGGGCGAGCAA
ACTGGACTCACTGGAGCTGCTGCTATCAATCATCATGCCGTATGCTGCCAACCGGTGCTGCAAACAGCCATGTTC
GATGTTACCGTCGACTCGGCAGGATTTATCAAGTCGGCCGACAGGACAACAGCGCTTGAACATCGAATCGACTTG
CCGTCCCACAACGAAACGAACATGCATATGATGCTGAGAGCTTTCATCAACTACGCATTACCCCATGCTTGGGTA
AATGAATACGGCTTTTATTTCCAATGTCCCTCGGAGCTTTTCGCGACTTTGTTTGGTGGAAGCACTGGAAGGGGA
AGGCAATTCCTCGAGACGCTTCATCCACTCCCGGACCCTGTCAAGCTTATACCGCTGGTAGAGGATTTCTATTCG
AAATATTTCGCCATCCTTCTCTGGAGTCGACAGGAGATATTCCAACGAGGTCGAGCCAGCGATAGTATCTTAGGG
AGCAGGCTTGTACCGGAGAGGAGAATCTTTATGGACCAATACGCCTTGGGCATAGTGACTGCGATTTTACTCATC
GATATCGCGGTCGCAATCGTCTTCTACTCGTCCATATCGGCAATCCGGATTCTGCCGCATATGCCGAACACGATT
GGGTCCCTGATTGCGTATATAGCCCCGAGCCGTCTCGTGGCCAGATGGAGGTCGAGATCGATCGACGAGAATACT
GCTATCCGCTTCGGCCGCTATCCCGTCGGGCTTGGTAGCGAACGGCATATCGGCATCGAGATGGAACAATATGTG
CTGCCCGTCGACGCTTACTGCCTGGAGAAAAGAGGGACGACGTGGAGGGCTTGGCTTTCGAAGCTGTCATGGCCG
TCATGGCGTACGATTCGGACTCGACCGCGACAACCGGAGGAGTCGGGAGGTCAGCCGGGCGGTCAGCCCGCCAGT
TTGAATACCGTCTAG
Gene >Hirsu2|7625
ATGACTGAAGCTTACGCCTCCGCGCGATTCGGCCGGTCCATGCCACCGTTCACTACGGAGGACTTTGCACTCCTA
CCGTTCTACGTGGATCAACAAGCCGTACGAGAACCGACAAAGTCGAACATCACTGCCAAAACCACCAGCCTTTTC
GCTAAACTCATCTGTACACCAGCCGCTGTCGGCAAGCCGACGTTCAACGACGCCAGATGGGGAACATGGGAAATT
TACCCGGTCAATGGCTCCCGTCAAAATAGTGGATGTAGGTACTTTTTAAAGCTTGATTCTGGGACAAAATACCCG
TTGCCAGACTACTGGGTTGATTATTTCGGAGTCGACGCGGCTTCAGGCTATTGGTTGCCTCCGCTTAAAAGTAAG
TGTCCACCAAACTCGTCGTCCCTGGCCCACTCAGCAATGGTCATATCGATGCTACAGCCCCCTCGCAAAGGGGGA
TTGACTGTAAGCCAGGTGGTGCCTCGAACGTGTGAGAGACGTTACTACAAACAGGAGGTCATGGCGACAGTGGAC
GCTTTCGACTTTAAAGTATACCCCGAGTCTCTCCGGTCTATCTCCGAACCGAGTCAACTGCTCCAGTTCGACAGT
CAAAGTTTCGAACAGCGACTGCTCCTGGACGGCTTTGGAATGGAATTTGGCAATGAGGATGGGGACAATCGATCT
GCCTCGGTAGACGAGATCGAGGAATTAATTGCAACCTATGAACCAGCAGCCTATACTTCAGCATGGGCGCTTATC
GCGACTCGGGCGTCGAGAATGCGTCTTTTTGCCGATACACTGCACGGACAAAACCTTCCTGCAGAGGCAAAGGTC
GACCGAGAGGCTCTCGAGAAAGCATTACATCGTGCGCATAGGTACCTTTTCTCGTACACAGTCTCGTCAACGCTC
GCAAACCAGACCGAACATGAACTCGGCAATCGAACTGCAATGATAGACACTCTGGCGTACGGAATTCTCGTTAGC
CCATACTTCGCGACTGCGGCAGAATCTCTGCTCCTACTTATCGCTATCATAGCATCAACCCTTTTATACTTCTGT
TGCAAAGCGCAATGCTACCTCCTATGGAACCCGAACTCCATTTCGCGACTCTGCTGTATCTGCAGTGCAAGCCCT
GGAATTATCAACTTATATAGAAGTTTAGCAACTACTAACGAAAAGATAGTCGAGTCATTACTGCAAGATAGCTTA
TTTCGGCTTTCACATTGCGGGTGCACCTACCGATGTCAACTTTGGCTCGAAGAGGTCAAGCCTAGTACTGCTATG
CGACCTGGAGATATAGGAACCGGACAGGCGAGGCTATCCGATATGGTGAATGCGCGAGCACACCATTACAAACCG
GCAATACCCTTCGAGGTTACTCGCAAGGCAGGCATCTTGTTAATAATTATCTTGCTCGGCATACTCGCGACATTT
GCTACACTCAAGTGGCAGGAAGTCAGTCAAGCCGGTAAGTTTATTCTCTTCCTCGCTTAGGACCAAGACTCTGTG
ACACGGAAAACAAAGGGGAAAGCATTCAAGCTACTTCATCAGCCGAGACAGTGATTCGTTAACACATACATGTGT
TTTAGGCCTCCGTCGACCATCGGAAGCCCCCGAAGTCTTGCTAGTCCTAGAGAAGGCTTTGCCCACGGCCTTTGC
GACATTGCTTGAGGCTTTCTGGTCTCTCTTGAACCTGCAACTCTGCGTCCTTCAGCCATTCCGGGAGCCATGCGC
AGGTACAAGCCGCATAGGCACAAGTATTGCTACGACATACTCAGCCGTCCCTCCGCAATTAACTATTTGGAGGGC
TTTAAAGGCTCGCCACTTTCTCCTAGTAGCTCTTTGCTTAACAAGTTTAGGAGCGAAGGCTCTGTTTATTGGCCT
TGGCGGGCTGTTTAACGAGAACGATACAACTGCTTGGCGCACACAAGCGTTCGAGCCTGTTCTGTCCCCATCATT
AAATATTTCCGCACTCGGTTCAACCATTCGGGAAATGTTAAGGACCGCCCAACATACCGAACGGCAGCAATCCAA
ATTTTCTCTGGACACCACTGCTCAGAATTCCGAGATAGTTCTATATGCACATTTCAGATATGGGACACGGCTGCC
TGCTTGGGTATCGTCGCGCTATTTCTTCCAGCCGCATCGACCAACGGGACAGGAAAGTGCATCGACTGACGTTTA
CGCCTTCAACACTCGAGGGTTCGGCCTGAACGCAAACTGTACTCCCTGCCTTCTGCATCCCCTCTTAAGCCAAAA
CGATAGGACCTCTTTAGATGCCATTGGCCGGTGTCCGGAAACGACCGTGCATGCAACTCCATGGACTGAAGACGG
TAAATGTGTGACTGAATTGGAGTCAGAGCTAGCATTAGACATAAAATGCGGCACGGCGTTTATGATAGGGTGGGA
TGTCTCCCCGGGCGAGCAAACTGGACTCACTGGAGCTGCTGCTATCAATCATCATGCCGTATGCTGCCAACCGGT
GCTGCAAACAGCCATGTTCGATGTTACCGTCGACTCGGCAGGATTTATCAAGTCGGCCGACAGGACAACAGCGCT
TGAACATCGAATCGACTTGCCGTCCCACAACGAAACGAACATGCATATGATGCTGAGAGCTTTCATCAACTACGC
ATTACCCCATGCTTGGGTAAATGAATACGGCTTTTATTTCCAATGTCCCTCGGAGCTTTTCGCGACTTTGTTTGG
TGGAAGCACTGGAAGGGGAAGGCAATTCCTCGAGACGCTTCATCCACTCCCGGACCCTGTCAAGCTTATACCGCT
GGTAGAGGATTTCTATTCGAAATATTTCGCCATCCTTCTCTGGAGTCGACAGGAGATATTCCAACGAGGTCGAGC
CAGCGATAGTATCTTAGGGAGCAGGCTTGTACCGGAGAGGAGAATCTTTATGGACCAATACGCCTTGGGCATAGT
GACTGCGATTTTACTCATCGATATCGCGGTCGCAATCGTCTTCTACTCGTCCATATCGGCAATCCGGATTCTGCC
GCATATGCCGAACACGATTGGGTCCCTGATTGCGTATATAGCCCCGAGCCGTCTCGTGGCCAGATGGAGGTCGAG
ATCGATCGACGAGAATACTGCTATCCGCTTCGGCCGCTATCCCGTCGGGCTTGGTAGCGAACGGCATATCGGCAT
CGAGATGGAACAATATGTGCTGCCCGTCGACGCTTACTGCCTGGAGAAAAGAGGGACGACGTGGAGGGCTTGGCT
TTCGAAGCTGTCATGGCCGTCATGGCGTACGATTCGGACTCGACCGCGACAACCGGAGGAGTCGGGAGGTCAGCC
GGGCGGTCAGCCCGCCAGTTTGAATACCGTCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail