Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7618
Gene name
LocationContig_451:9354..12107
Strand+
Gene length (bp)2753
Transcript length (bp)2637
Coding sequence length (bp)2637
Protein length (aa) 879

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 7.4E-171 162 834

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 94 872 6.0E-153
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 1 877 2.0E-140
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 142 871 4.0E-125
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 141 861 5.0E-119
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 131 851 3.0E-117
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 94 872 6.0E-153
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 1 877 2.0E-140
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 142 871 4.0E-125
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 141 861 5.0E-119
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 131 851 3.0E-117
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 66 871 3.0E-112
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 142 867 2.0E-111
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 141 867 2.0E-110
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 142 859 4.0E-108
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 143 867 1.0E-101
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 103 860 4.0E-97
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 147 859 3.0E-95
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 147 859 2.0E-94
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 147 859 3.0E-91
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

Domain # Start End Length
1 165 187 22
2 238 260 22
3 273 295 22
4 299 321 22
5 342 364 22
6 417 439 22
7 488 510 22
8 555 577 22
9 584 603 19
10 666 685 19
11 706 723 17
12 733 755 22
13 776 798 22
14 813 835 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7618
MADDEKSVAATRVAEQPPRASVALTDKSQDSAEEPFSYDEDDRYFHDAAHQQQQRMATEHDLNVTEDDLLEAKEL
ASQYTLDEVRDIMTRVRRVHEKDPNFPSAVIQKIKAFLDNESVFSQPEKHQHLIQEMKLEAALVTSNSPYAEVRA
VVSNKDNVNTPCSTIRSWAIGLLFSVLLAFINQLFDIRQPAIRVMANVAQLLAYPIGKVAENWLPDRGFTLFGVR
HTLNPGPFSKKEHMLITIMANVAYNTPYTNYIIWVQFLPQYFDQPYASHFAYQLLIALATNFIGYGIAGMCRRFL
VYPSYCVWPASLVTIALNSAFHTDANPPVEGPFRKIWRISRIKFFYLMFAAMFVWFWFPGYIWVGLSKFNWLSWI
APGHRDLNVVTGINHGLGVNPFPTWDWNVLLWDSADPLMVPFFSTLNRFIGVFVSFWVVLIFWYKNVYNTGYLPI
NTNRVYDHFAQLYNVTRATDDHGLFNQDKYSAYSPPYLGAGNIVIYMFFFGIYTSTLTYAALYHRHEIAMGFKAL
FNSLRRKRPLQEERVLDVHNRLMKAYPEVPEWWYVGCLAIAIAFGVAGIAGWDTHTSPGVVFYGLALCVVFVIPV
GIIKAMTGIEVTLNVLAEFVGGSWVDGNALAMNYFKSFGYVTCAHAIWFCNDLKLAHYVKIPPRHTFVAQIVATF
ISSIVCIGVLNFQMLNIDDVCTPKAQYKLTCPGVNTFFTASVLWGTVGPEKIFGHQGQYSATLVGFPLGVLIVVF
FWALSKKFPHWTWTRQIHPVAIMYGGIVWAPYNMSYVWPSVPIAYFSWIYLKSRYLGLWSKYNFVLSAAWSCGIA
IAGIIIFFSLQYTGTDLNWWGNRVSEMGCEGNACALKTLAPGEYFGPRIGEFS*
Coding >Hirsu2|7618
ATGGCCGACGACGAGAAGAGCGTCGCCGCGACCCGGGTGGCCGAGCAGCCGCCGCGCGCCTCCGTCGCCTTGACC
GACAAGTCCCAGGACAGCGCCGAGGAGCCCTTCTCGTACGACGAAGACGATCGCTACTTCCATGATGCCGCCCAC
CAGCAGCAGCAGCGCATGGCGACGGAACATGACCTCAACGTCACCGAGGACGACCTGCTCGAGGCCAAGGAGCTC
GCCTCGCAGTACACGCTCGACGAGGTCCGCGACATCATGACCCGCGTCCGTCGCGTGCACGAAAAGGACCCCAAC
TTCCCCTCGGCCGTCATCCAGAAGATCAAGGCCTTCCTCGACAACGAGTCCGTCTTCTCCCAGCCCGAGAAGCAC
CAGCACCTCATCCAAGAGATGAAGCTCGAGGCCGCCCTCGTCACCAGCAACAGCCCCTACGCCGAGGTCCGCGCC
GTCGTCAGCAACAAGGACAATGTCAACACGCCCTGCTCCACCATCCGCAGCTGGGCCATCGGCCTCCTCTTCTCC
GTCCTCCTCGCCTTCATCAATCAGCTCTTCGACATCCGCCAGCCCGCCATCCGCGTCATGGCCAACGTCGCACAG
CTCCTGGCCTATCCCATTGGCAAGGTCGCCGAGAATTGGCTGCCGGACAGGGGCTTCACCCTCTTCGGCGTCCGC
CACACGCTGAACCCCGGGCCCTTCTCCAAGAAGGAGCACATGCTTATCACCATCATGGCCAACGTCGCCTACAAC
ACCCCCTACACCAACTACATCATCTGGGTCCAGTTCCTGCCCCAGTACTTCGACCAGCCCTACGCCTCACACTTC
GCCTACCAGCTTCTCATCGCCCTCGCCACCAACTTCATCGGATACGGCATCGCTGGCATGTGTCGCCGCTTCCTC
GTCTACCCCTCCTACTGCGTCTGGCCCGCCTCCCTCGTCACCATCGCCCTCAACTCGGCCTTCCACACCGACGCC
AACCCTCCCGTCGAGGGGCCCTTCCGCAAGATCTGGCGCATCTCGAGGATCAAGTTCTTCTACCTCATGTTCGCC
GCCATGTTCGTCTGGTTCTGGTTCCCCGGCTACATCTGGGTCGGCCTGTCCAAGTTCAACTGGCTCAGCTGGATC
GCGCCGGGCCACCGCGACCTCAACGTCGTCACCGGCATCAACCACGGCCTCGGCGTCAACCCCTTCCCCACCTGG
GACTGGAACGTCCTCCTGTGGGACTCAGCCGACCCGCTCATGGTCCCCTTCTTCAGCACCCTCAACCGCTTCATC
GGCGTCTTCGTCTCATTCTGGGTCGTCCTCATCTTCTGGTACAAGAACGTCTACAACACGGGCTACCTGCCCATC
AACACCAACCGCGTCTACGACCACTTTGCCCAGCTCTACAACGTGACGCGCGCCACCGACGACCACGGCCTCTTC
AACCAGGACAAGTACTCTGCCTACTCCCCCCCCTACCTGGGAGCCGGCAACATCGTCATCTACATGTTCTTCTTC
GGCATCTACACGTCCACGCTCACCTACGCCGCCCTCTATCACCGCCACGAGATCGCCATGGGCTTCAAGGCCCTC
TTCAACAGCCTGCGCAGGAAGAGGCCGTTGCAGGAGGAGCGCGTGCTGGACGTGCACAACCGGCTCATGAAGGCC
TACCCCGAGGTCCCCGAGTGGTGGTACGTCGGCTGCCTGGCCATTGCCATCGCCTTTGGCGTCGCCGGCATCGCA
GGCTGGGACACGCACACGTCCCCCGGCGTCGTCTTCTACGGCCTCGCCCTCTGCGTCGTCTTCGTCATACCTGTC
GGCATCATCAAGGCCATGACGGGCATCGAGGTCACCCTCAACGTCCTGGCCGAGTTCGTCGGCGGCTCCTGGGTC
GACGGCAACGCCCTCGCCATGAACTACTTCAAGTCCTTCGGCTACGTCACATGCGCCCACGCCATCTGGTTCTGC
AACGACCTGAAGCTCGCTCACTACGTCAAGATCCCGCCCCGCCACACCTTCGTCGCCCAGATCGTCGCCACCTTC
ATCAGCAGCATCGTCTGCATCGGTGTCTTGAACTTTCAGATGCTCAACATCGACGACGTGTGCACGCCCAAGGCC
CAGTACAAGCTGACGTGCCCCGGGGTCAACACCTTCTTCACCGCCTCCGTGCTATGGGGCACCGTCGGCCCCGAG
AAGATCTTTGGGCACCAGGGCCAGTACAGCGCCACCCTCGTCGGCTTCCCGCTCGGCGTCCTCATCGTCGTCTTC
TTCTGGGCCCTCAGCAAAAAGTTCCCCCACTGGACGTGGACGCGGCAGATCCACCCGGTGGCCATCATGTACGGC
GGCATCGTCTGGGCGCCGTACAACATGTCGTACGTGTGGCCCTCGGTGCCCATTGCCTACTTCTCCTGGATCTAC
CTCAAGTCCCGCTACCTCGGCCTGTGGTCCAAGTACAACTTTGTCCTCTCGGCGGCGTGGTCGTGCGGCATCGCC
ATCGCGGGCATCATCATCTTCTTCAGCCTGCAGTACACCGGGACCGACCTCAACTGGTGGGGGAACAGGGTGTCG
GAGATGGGTTGCGAGGGCAATGCTTGCGCACTCAAGACGCTCGCCCCGGGGGAGTATTTCGGGCCACGGATAGGG
GAGTTCAGCTAA
Transcript >Hirsu2|7618
ATGGCCGACGACGAGAAGAGCGTCGCCGCGACCCGGGTGGCCGAGCAGCCGCCGCGCGCCTCCGTCGCCTTGACC
GACAAGTCCCAGGACAGCGCCGAGGAGCCCTTCTCGTACGACGAAGACGATCGCTACTTCCATGATGCCGCCCAC
CAGCAGCAGCAGCGCATGGCGACGGAACATGACCTCAACGTCACCGAGGACGACCTGCTCGAGGCCAAGGAGCTC
GCCTCGCAGTACACGCTCGACGAGGTCCGCGACATCATGACCCGCGTCCGTCGCGTGCACGAAAAGGACCCCAAC
TTCCCCTCGGCCGTCATCCAGAAGATCAAGGCCTTCCTCGACAACGAGTCCGTCTTCTCCCAGCCCGAGAAGCAC
CAGCACCTCATCCAAGAGATGAAGCTCGAGGCCGCCCTCGTCACCAGCAACAGCCCCTACGCCGAGGTCCGCGCC
GTCGTCAGCAACAAGGACAATGTCAACACGCCCTGCTCCACCATCCGCAGCTGGGCCATCGGCCTCCTCTTCTCC
GTCCTCCTCGCCTTCATCAATCAGCTCTTCGACATCCGCCAGCCCGCCATCCGCGTCATGGCCAACGTCGCACAG
CTCCTGGCCTATCCCATTGGCAAGGTCGCCGAGAATTGGCTGCCGGACAGGGGCTTCACCCTCTTCGGCGTCCGC
CACACGCTGAACCCCGGGCCCTTCTCCAAGAAGGAGCACATGCTTATCACCATCATGGCCAACGTCGCCTACAAC
ACCCCCTACACCAACTACATCATCTGGGTCCAGTTCCTGCCCCAGTACTTCGACCAGCCCTACGCCTCACACTTC
GCCTACCAGCTTCTCATCGCCCTCGCCACCAACTTCATCGGATACGGCATCGCTGGCATGTGTCGCCGCTTCCTC
GTCTACCCCTCCTACTGCGTCTGGCCCGCCTCCCTCGTCACCATCGCCCTCAACTCGGCCTTCCACACCGACGCC
AACCCTCCCGTCGAGGGGCCCTTCCGCAAGATCTGGCGCATCTCGAGGATCAAGTTCTTCTACCTCATGTTCGCC
GCCATGTTCGTCTGGTTCTGGTTCCCCGGCTACATCTGGGTCGGCCTGTCCAAGTTCAACTGGCTCAGCTGGATC
GCGCCGGGCCACCGCGACCTCAACGTCGTCACCGGCATCAACCACGGCCTCGGCGTCAACCCCTTCCCCACCTGG
GACTGGAACGTCCTCCTGTGGGACTCAGCCGACCCGCTCATGGTCCCCTTCTTCAGCACCCTCAACCGCTTCATC
GGCGTCTTCGTCTCATTCTGGGTCGTCCTCATCTTCTGGTACAAGAACGTCTACAACACGGGCTACCTGCCCATC
AACACCAACCGCGTCTACGACCACTTTGCCCAGCTCTACAACGTGACGCGCGCCACCGACGACCACGGCCTCTTC
AACCAGGACAAGTACTCTGCCTACTCCCCCCCCTACCTGGGAGCCGGCAACATCGTCATCTACATGTTCTTCTTC
GGCATCTACACGTCCACGCTCACCTACGCCGCCCTCTATCACCGCCACGAGATCGCCATGGGCTTCAAGGCCCTC
TTCAACAGCCTGCGCAGGAAGAGGCCGTTGCAGGAGGAGCGCGTGCTGGACGTGCACAACCGGCTCATGAAGGCC
TACCCCGAGGTCCCCGAGTGGTGGTACGTCGGCTGCCTGGCCATTGCCATCGCCTTTGGCGTCGCCGGCATCGCA
GGCTGGGACACGCACACGTCCCCCGGCGTCGTCTTCTACGGCCTCGCCCTCTGCGTCGTCTTCGTCATACCTGTC
GGCATCATCAAGGCCATGACGGGCATCGAGGTCACCCTCAACGTCCTGGCCGAGTTCGTCGGCGGCTCCTGGGTC
GACGGCAACGCCCTCGCCATGAACTACTTCAAGTCCTTCGGCTACGTCACATGCGCCCACGCCATCTGGTTCTGC
AACGACCTGAAGCTCGCTCACTACGTCAAGATCCCGCCCCGCCACACCTTCGTCGCCCAGATCGTCGCCACCTTC
ATCAGCAGCATCGTCTGCATCGGTGTCTTGAACTTTCAGATGCTCAACATCGACGACGTGTGCACGCCCAAGGCC
CAGTACAAGCTGACGTGCCCCGGGGTCAACACCTTCTTCACCGCCTCCGTGCTATGGGGCACCGTCGGCCCCGAG
AAGATCTTTGGGCACCAGGGCCAGTACAGCGCCACCCTCGTCGGCTTCCCGCTCGGCGTCCTCATCGTCGTCTTC
TTCTGGGCCCTCAGCAAAAAGTTCCCCCACTGGACGTGGACGCGGCAGATCCACCCGGTGGCCATCATGTACGGC
GGCATCGTCTGGGCGCCGTACAACATGTCGTACGTGTGGCCCTCGGTGCCCATTGCCTACTTCTCCTGGATCTAC
CTCAAGTCCCGCTACCTCGGCCTGTGGTCCAAGTACAACTTTGTCCTCTCGGCGGCGTGGTCGTGCGGCATCGCC
ATCGCGGGCATCATCATCTTCTTCAGCCTGCAGTACACCGGGACCGACCTCAACTGGTGGGGGAACAGGGTGTCG
GAGATGGGTTGCGAGGGCAATGCTTGCGCACTCAAGACGCTCGCCCCGGGGGAGTATTTCGGGCCACGGATAGGG
GAGTTCAGCTAA
Gene >Hirsu2|7618
ATGGCCGACGACGAGAAGAGCGTCGCCGCGACCCGGGTGGCCGAGCAGCCGCCGCGCGCCTCCGTCGCCTTGACC
GACAAGTCCCAGGACAGCGCCGTAAGTCCCCCAACGGCCTCGACCGACGAGATGACGGCCGACGCTCACCCGCTT
CAGCAGGAGGAGCCCTTCTCGTACGACGAAGACGATCGCTACTTCCATGATGCCGCCCACCAGCAGCAGCAGCGC
ATGGCGACGGAACATGACCTCAACGTCACCGAGGACGACCTGCTCGAGGCCAAGGAGCTCGCCTCGCAGTACACG
CTCGACGAGGTCCGCGACATCATGACCCGCGTCCGTCGCGTGCACGAAAAGGACCCCAACTTCCCCTCGGCCGTC
ATCCAGAAGATCAAGGCCTTCCTCGACAACGAGTCCGTCTTCTCCCAGCCCGAGAAGCACCAGCACCTCATCCAA
GAGATGAAGCTCGAGGCCGCCCTCGTCACCAGCAACAGCCCCTACGCCGAGGTCCGCGCCGTCGTCAGCAACAAG
GACAATGTCAACACGCCCTGCTCCACCATCCGCAGCTGGGCCATCGGCCTCCTCTTCTCCGTCCTCCTCGCCTTC
ATCAATCAGCTCTTCGACATCCGCCAGCCCGCCATCCGCGTCATGGCCAACGTCGCACAGCTCCTGGCCTATCCC
ATTGGCAAGGTCGCCGAGAATTGGCTGCCGGACAGGGGCTTCACCCTCTTCGGCGTCCGCCACACGCTGAACCCC
GGGCCCTTCTCCAAGAAGGAGCACATGCTTATCACCATCATGGCCAACGTCGCCTACAACACCCCCTACACCAAC
TACATCATCTGGGTCCAGTTCCTGCCCCAGTACTTCGACCAGCCCTACGCCTCACACTTCGCCTACCAGCTTCTC
ATCGCCCTCGCCACCAACTTCATCGGATACGGCATCGCTGGCATGTGTCGCCGCTTCCTCGTCTACCCCTCCTAC
TGCGTCTGGCCCGCCTCCCTCGTCACCATCGCCCTCAACTCGGCCTTCCACACCGACGCCAACCCTCCCGTCGAG
GGGCCCTTCCGCAAGATCTGGCGCATCTCGAGGATCAAGTTCTTCTACCTCATGTTCGCCGCCATGTTCGTCTGG
TTCTGGTTCCCCGGCTACATCTGGGTCGGCCTGTCCAAGTTCAACTGGCTCAGCTGGATCGCGCCGGGCCACCGC
GACCTCAACGTCGTCACCGGCATCAACCACGGCCTCGGCGTCAACCCCTTCCCCACCTGGGACTGGAACGTCCTC
CTGTGGGACTCAGCCGACCCGCTCATGGTCCCCTTCTTCAGCACCCTCAACCGCTTCATCGGCGTCTTCGTCTCA
TTCTGGGTCGTCCTCATCTTCTGGTACAAGAACGTCTACAACACGGGCTACCTGCCCATCAACACCAACCGCGTC
TACGACCACTTTGCCCAGCTCTACAACGTGACGCGCGCCACCGACGACCACGGCCTCTTCAACCAGGACAAGTAC
TCTGCCTACTCCCCCCCCTACCTGGGAGCCGGCAACATCGTCATCTACATGTTCTTCTTCGGCATCTACACGTCC
ACGCTCACCTACGCCGCCCTCTATCACCGCCACGAGATCGCCATGGGCTTCAAGGCCCTCTTCAACAGCCTGCGC
AGGAAGAGGCCGTTGCAGGAGGAGCGCGTGCTGGACGTGCACAACCGGCTCATGAAGGCCTACCCCGAGGTCCCC
GAGTGGTGGTACGTCGGCTGCCTGGCCATTGCCATCGCCTTTGGCGTCGCCGGCATCGCAGGCTGGGACACGCAC
ACGTCCCCCGGCGTCGTCTTCTACGGCCTCGCCCTCTGCGTCGTCTTCGTCATACCTGTCGGCATCATCAAGGCC
ATGACGGGCATCGAGGTCACCCTCAACGTCCTGGCCGAGTTCGTCGGCGGCTCCTGGGTCGACGGCAACGCCCTC
GCCATGAACTACTTCAAGTCCTTCGGCTACGTCACATGCGCCCACGCCATCTGGTTCTGCAACGACCTGAAGCTC
GCTCACTACGTCAAGATCCCGCCCCGCCACACCTTCGTCGCCCAGATCGTCGCCACCTTCATCAGCAGCATCGTC
TGCATCGGTGTCTTGAACTTTCAGATGCTCAACATCGACGACGTGTGCACGCCCAAGGCCCAGTACAAGCTGACG
TGCCCCGGGGTCAACACCTTCTTCACCGCCTCCGTGCTATGGGGCACCGTCGGCCCCGAGAAGATCTTTGGGCAC
CAGGGCCAGTACAGCGCCACCCTCGTCGGCTTCCCGCTCGGCGTCCTCATCGTCGTCTTCTTCTGGGCCCTCAGC
AAAAAGTTCCCCCACTGGACGTGGACGCGGCAGATCCACCCGGTGGCCATCATGTACGGCGGCATCGTCTGGGCG
CCGTACAACATGTCGTACGTGTGGCCCTCGGTGCCCATTGCCTACTTCTCCTGGATCTACCTCAAGTCCCGCTAC
CTCGGCCTGTGGTCCAAGGTACGTGTGCGCCCTGCCCCCGCCGGGGCCGGGTCCCGACGCTGACGTTTCCGCAGT
ACAACTTTGTCCTCTCGGCGGCGTGGTCGTGCGGCATCGCCATCGCGGGCATCATCATCTTCTTCAGCCTGCAGT
ACACCGGGACCGACCTCAACTGGTGGGGGAACAGGGTGTCGGAGATGGGTTGCGAGGGCAATGCTTGCGCACTCA
AGACGCTCGCCCCGGGGGAGTATTTCGGGCCACGGATAGGGGAGTTCAGCTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail