Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7610
Gene name
LocationContig_450:2519..4819
Strand-
Gene length (bp)2300
Transcript length (bp)1581
Coding sequence length (bp)1581
Protein length (aa) 527

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00474 SSF Sodium:solute symporter family 3.7E-10 44 203

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q7XBS0|DUR3_ORYSJ Urea-proton symporter DUR3 OS=Oryza sativa subsp. japonica GN=DUR3 PE=1 SV=1 2 188 2.0E-06
sp|O94469|DUR31_SCHPO Probable urea active transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dur3-1 PE=3 SV=1 27 198 4.0E-06

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 47 69 22
3 79 101 22
4 122 141 19
5 161 183 22
6 190 207 17
7 227 249 22
8 269 291 22
9 311 333 22
10 354 373 19
11 378 400 22
12 413 435 22
13 455 477 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7610
MGQPATAASNAIIYVTYGAFLITGTGIAWTMRRQSKREFLSSNGTQSAFPLALNFIASAFGTGILFSYPELATVA
GVQGVIVYAFASSLPMLVFGAVGPVIRRKCPSGFVLTEWTRQRYGSVTMLYLSFLTLLTLFLYMVADLSALGQVV
EALTGLDKLPVIIVECFVTTVYTSLGGFRISFLTDAIQGAMVVGLLILATITIGVKTDIRPELIDSSGLTRPSLL
GWQLLYILPVAVVTNDFFLSSFWLRTFSSRSDRDLWVAVSLSTAVLLCATTLVGCTGLIAVWSGAWPGSGAAAAA
PPPPLFALLERMPGWVVGVVLVMTVTLSTAAFDSLQSAMVSSASNDLFRNRLSIWYTRAMVVAVIVPVVVVALKA
ASILQIYLICDLLSAATVPVLCVGLVDRFHFWRGFEVVVGGLGGVLSVFVFGTVYLGSAAEGARLLILQRGLYAS
DWSAFGAFVAAPLGGLLCGLAALGLRLAFQFVRARAAGERFDALDRPPADTQEIVGDDPDAPPEAAVTVSKPGKF
F*
Coding >Hirsu2|7610
ATGGGCCAGCCAGCGACTGCGGCGTCCAACGCCATCATCTACGTCACGTATGGCGCCTTCTTGATTACGGGTACC
GGCATTGCCTGGACCATGAGGAGACAGAGCAAGAGAGAGTTTCTGTCGAGCAACGGAACGCAATCTGCGTTTCCT
CTCGCCCTCAACTTCATCGCGTCTGCCTTCGGCACCGGCATCCTCTTCTCCTATCCGGAGCTCGCCACCGTCGCC
GGCGTGCAGGGCGTCATCGTCTATGCCTTTGCCTCGTCGCTGCCGATGCTGGTGTTTGGGGCCGTGGGCCCCGTC
ATCCGGCGCAAGTGCCCTTCGGGCTTCGTCCTGACGGAGTGGACGCGCCAGCGCTACGGCAGCGTCACCATGCTC
TACCTCAGCTTCCTCACCCTCCTCACCCTCTTCCTGTACATGGTGGCCGACCTGTCGGCGCTGGGGCAGGTCGTC
GAGGCCCTGACGGGGCTCGACAAGCTGCCCGTCATCATCGTCGAGTGCTTCGTCACGACCGTCTACACCTCTCTC
GGCGGCTTCCGAATCTCCTTCCTGACCGACGCCATCCAGGGCGCCATGGTGGTCGGGCTCCTGATCCTGGCGACC
ATCACCATCGGGGTCAAGACGGACATCCGGCCGGAGCTGATCGACTCGTCGGGCCTGACCAGGCCCTCGCTGCTC
GGCTGGCAGCTGCTGTACATCCTCCCCGTCGCCGTCGTCACCAACGACTTCTTCCTCTCCAGCTTCTGGCTGCGG
ACCTTCTCGTCGCGGTCGGACCGGGACCTGTGGGTGGCCGTCTCGCTCTCGACGGCCGTCCTCCTGTGCGCCACC
ACCCTCGTCGGCTGCACGGGGCTGATCGCCGTCTGGTCGGGCGCGTGGCCGGGCAGCGGCGCGGCCGCCGCCGCG
CCGCCGCCGCCGCTGTTCGCCCTGCTGGAGCGGATGCCGGGCTGGGTGGTGGGCGTCGTGCTGGTGATGACGGTG
ACGCTGAGCACGGCCGCCTTCGACAGCCTGCAGTCGGCCATGGTCTCGTCGGCGTCCAACGACCTGTTCCGCAAC
CGGCTGAGCATCTGGTACACGCGCGCCATGGTCGTCGCCGTCATCGTCCCCGTCGTCGTCGTCGCCCTCAAGGCC
GCCTCCATCCTGCAGATCTACCTCATCTGCGACCTGCTGTCGGCCGCCACCGTGCCCGTCCTGTGCGTCGGCCTC
GTCGACCGCTTCCACTTCTGGCGCGGCTTCGAGGTCGTCGTCGGCGGCCTCGGCGGCGTCCTCAGCGTCTTCGTC
TTCGGCACCGTCTACCTCGGCTCCGCCGCCGAGGGCGCCCGCCTGCTCATCCTCCAGCGCGGCCTGTACGCCAGC
GACTGGAGCGCCTTTGGCGCCTTCGTCGCCGCCCCGCTCGGCGGCCTGCTCTGCGGCCTCGCCGCCCTCGGCCTG
CGGCTGGCCTTCCAGTTCGTCAGGGCCCGGGCCGCGGGCGAGCGCTTCGACGCCCTGGACCGGCCCCCCGCCGAC
ACCCAAGAGATCGTCGGCGACGACCCGGACGCTCCGCCCGAGGCGGCCGTGACGGTCTCGAAGCCGGGCAAGTTC
TTCTAG
Transcript >Hirsu2|7610
ATGGGCCAGCCAGCGACTGCGGCGTCCAACGCCATCATCTACGTCACGTATGGCGCCTTCTTGATTACGGGTACC
GGCATTGCCTGGACCATGAGGAGACAGAGCAAGAGAGAGTTTCTGTCGAGCAACGGAACGCAATCTGCGTTTCCT
CTCGCCCTCAACTTCATCGCGTCTGCCTTCGGCACCGGCATCCTCTTCTCCTATCCGGAGCTCGCCACCGTCGCC
GGCGTGCAGGGCGTCATCGTCTATGCCTTTGCCTCGTCGCTGCCGATGCTGGTGTTTGGGGCCGTGGGCCCCGTC
ATCCGGCGCAAGTGCCCTTCGGGCTTCGTCCTGACGGAGTGGACGCGCCAGCGCTACGGCAGCGTCACCATGCTC
TACCTCAGCTTCCTCACCCTCCTCACCCTCTTCCTGTACATGGTGGCCGACCTGTCGGCGCTGGGGCAGGTCGTC
GAGGCCCTGACGGGGCTCGACAAGCTGCCCGTCATCATCGTCGAGTGCTTCGTCACGACCGTCTACACCTCTCTC
GGCGGCTTCCGAATCTCCTTCCTGACCGACGCCATCCAGGGCGCCATGGTGGTCGGGCTCCTGATCCTGGCGACC
ATCACCATCGGGGTCAAGACGGACATCCGGCCGGAGCTGATCGACTCGTCGGGCCTGACCAGGCCCTCGCTGCTC
GGCTGGCAGCTGCTGTACATCCTCCCCGTCGCCGTCGTCACCAACGACTTCTTCCTCTCCAGCTTCTGGCTGCGG
ACCTTCTCGTCGCGGTCGGACCGGGACCTGTGGGTGGCCGTCTCGCTCTCGACGGCCGTCCTCCTGTGCGCCACC
ACCCTCGTCGGCTGCACGGGGCTGATCGCCGTCTGGTCGGGCGCGTGGCCGGGCAGCGGCGCGGCCGCCGCCGCG
CCGCCGCCGCCGCTGTTCGCCCTGCTGGAGCGGATGCCGGGCTGGGTGGTGGGCGTCGTGCTGGTGATGACGGTG
ACGCTGAGCACGGCCGCCTTCGACAGCCTGCAGTCGGCCATGGTCTCGTCGGCGTCCAACGACCTGTTCCGCAAC
CGGCTGAGCATCTGGTACACGCGCGCCATGGTCGTCGCCGTCATCGTCCCCGTCGTCGTCGTCGCCCTCAAGGCC
GCCTCCATCCTGCAGATCTACCTCATCTGCGACCTGCTGTCGGCCGCCACCGTGCCCGTCCTGTGCGTCGGCCTC
GTCGACCGCTTCCACTTCTGGCGCGGCTTCGAGGTCGTCGTCGGCGGCCTCGGCGGCGTCCTCAGCGTCTTCGTC
TTCGGCACCGTCTACCTCGGCTCCGCCGCCGAGGGCGCCCGCCTGCTCATCCTCCAGCGCGGCCTGTACGCCAGC
GACTGGAGCGCCTTTGGCGCCTTCGTCGCCGCCCCGCTCGGCGGCCTGCTCTGCGGCCTCGCCGCCCTCGGCCTG
CGGCTGGCCTTCCAGTTCGTCAGGGCCCGGGCCGCGGGCGAGCGCTTCGACGCCCTGGACCGGCCCCCCGCCGAC
ACCCAAGAGATCGTCGGCGACGACCCGGACGCTCCGCCCGAGGCGGCCGTGACGGTCTCGAAGCCGGGCAAGTTC
TTCTAG
Gene >Hirsu2|7610
ATGGGCCAGCCAGCGACTGCGGCGTCCAACGCCATCATCTACGTCACGTATGGCGCCTTCTTGTAAGAACAGCCT
GCGCCCTTTGCCGCGTCAGAGGCGGGCGGGAGAGGCTGACCGGGACGGGTGCGGGGACGGCATCAGGATTACGGG
TACCGGCATTGCCTGGACCATGAGGAGACAGAGCAAGAGAGAGTTTCTGTCGAGCAACGGAACGCAATCTGGTCG
GCGATGTCCCTTCCCCGAGCGCTGCTGGTACGGGCTAACGCAGCGCGACAGCGTTTCCTCTCGCCCTCAACTTCA
TCGCGTCTGGTGAGTAGAGCGTCTCGTCACAAGGAGGAGAGCGGTGGCCTTTTCCCGGCCGTGGGCGCGGCATGG
CAGGTCCACGGCGCGCGCGGTCCGGGTGGCTGGGCATATGATGCGTTGAGCAACGGGTAGGTTCGTTCGTACCCT
GGGACTCTGTCTTCGCCTCTCGATGCACGAGTCGCCCTCCCCCCCTCCTCCTTTTTCACCCACGGAGACTTGCGA
TGGGCCCGAGGCGCGAGAGAGAGAGAGCGGGAGCGGGAGCGGCTCCGCGATGCGCGAGGGGCGAGGACGCGGCTC
ACTACGGGCGCCGAGTTGGAGCGGCGCGAGGCATCCAACCTCCCCGGTCCGAAGGGGGGGAGATGCCGGCACGCG
ACAACGAAGCTGAGATTGCACCGTCATACTCGATCAAGTTAATGCTTGCGTGGGAAACGTGCTGCCGCTCACCCT
TCCCCCGCCCCTTTGGTGCATTCCCGAACTGACAGCAGGAAAGCCTTCGGCACCGGCATCCTCTTCTCCTATCCG
GAGCTCGCCACCGTCGCCGGCGTGCAGGGCGTCATCGTCTATGCCTTTGCCTCGTCGCTGCCGATGCTGGTGTTT
GGGGCCGTGGGCCCCGTCATCCGGCGCAAGTGCCCTTCGGGCTTCGTCCTGACGGAGTGGACGCGCCAGCGCTAC
GGCAGCGTCACCATGCTCTACCTCAGCTTCCTCACCCTCCTCACCCTCTTCCTGTACATGGTGGCCGACCTGTCG
GCGCTGGGGCAGGTCGTCGAGGCCCTGACGGGGCTCGACAAGCTGCCCGTCATCATCGTCGAGTGCTTCGTCACG
ACCGTCTACACCTGTGAGCCTCCTCTCCACCTCTGCCCGACGGCTCTCGCGGCGCGGCTGCGCGACATTTCGGAT
GGGGATACGCTGACGACGGCGGGCCGCGGCCCCCCTTAGCTCTCGGCGGCTTCCGAATCTCCTTCCTGACCGACG
CCATCCAGGGCGCCATGGTGGTCGGGCTCCTGATCCTGGCGACCATCACCATCGGGGTCAAGACGGACATCCGGC
CGGAGCTGATCGACTCGTCGGGCCTGACCAGGCCCTCGCTGCTCGGCTGGCAGCTGCTGTACATCCTCCCCGTCG
CCGTCGTCACCAACGACTTCTTCCTCTCCAGCTTCTGGCTGCGGACCTTCTCGTCGCGGTCGGACCGGGACCTGT
GGGTGGCCGTCTCGCTCTCGACGGCCGTCCTCCTGTGCGCCACCACCCTCGTCGGCTGCACGGGGCTGATCGCCG
TCTGGTCGGGCGCGTGGCCGGGCAGCGGCGCGGCCGCCGCCGCGCCGCCGCCGCCGCTGTTCGCCCTGCTGGAGC
GGATGCCGGGCTGGGTGGTGGGCGTCGTGCTGGTGATGACGGTGACGCTGAGCACGGCCGCCTTCGACAGCCTGC
AGTCGGCCATGGTCTCGTCGGCGTCCAACGACCTGTTCCGCAACCGGCTGAGCATCTGGTACACGCGCGCCATGG
TCGTCGCCGTCATCGTCCCCGTCGTCGTCGTCGCCCTCAAGGCCGCCTCCATCCTGCAGATCTACCTCATCTGCG
ACCTGCTGTCGGCCGCCACCGTGCCCGTCCTGTGCGTCGGCCTCGTCGACCGCTTCCACTTCTGGCGCGGCTTCG
AGGTCGTCGTCGGCGGCCTCGGCGGCGTCCTCAGCGTCTTCGTCTTCGGCACCGTCTACCTCGGCTCCGCCGCCG
AGGGCGCCCGCCTGCTCATCCTCCAGCGCGGCCTGTACGCCAGCGACTGGAGCGCCTTTGGCGCCTTCGTCGCCG
CCCCGCTCGGCGGCCTGCTCTGCGGCCTCGCCGCCCTCGGCCTGCGGCTGGCCTTCCAGTTCGTCAGGGCCCGGG
CCGCGGGCGAGCGCTTCGACGCCCTGGACCGGCCCCCCGCCGACACCCAAGAGATCGTCGGCGACGACCCGGACG
CTCCGCCCGAGGCGGCCGTGACGGTCTCGAAGCCGGGCAAGTTCTTCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail