Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7598
Gene name
LocationContig_45:28434..29309
Strand+
Gene length (bp)875
Transcript length (bp)807
Coding sequence length (bp)807
Protein length (aa) 269

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13398 Peptidase_M50B Peptidase M50B-like 6.9E-60 41 242

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 34 53 19
2 60 82 22
3 102 124 22
4 129 151 22
5 156 178 22
6 183 200 17
7 229 251 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7598
MAPRALLPNVSFDESDRLHLLAARDLQNPTRTQQITLGVIAVYVVAIAILWNVPYLKMILWPFKMLVIAFHEFGH
AITAVLTGGKVKSISLDPNEGGVTHMQGGISAITLPAGYLGSSIIGALLTFCGFNIVASKIASIVLGVCFLLTLW
WGKRDWLTILTVLSAVGLLVACWFIVHAEALRFVVLFIGVMSSLYSVWDICDDLILRKVNSSDASVFAKRYGGSS
QCWGVIWSIISILVMAVGIVAGLAAFSQSFEQQQQDSQHFLPT*
Coding >Hirsu2|7598
ATGGCGCCTCGGGCCCTGCTGCCGAACGTCAGCTTCGACGAAAGCGACAGGCTCCATCTTCTCGCCGCCCGCGAC
CTTCAGAACCCGACGCGCACGCAGCAGATCACTTTGGGCGTCATCGCCGTGTACGTCGTTGCCATCGCCATCCTG
TGGAACGTCCCGTATCTCAAAATGATCCTCTGGCCCTTCAAGATGCTCGTCATCGCATTCCACGAATTCGGTCAT
GCCATTACCGCTGTCCTGACCGGCGGGAAAGTCAAGTCCATCAGCCTCGATCCCAACGAAGGCGGCGTCACTCAC
ATGCAGGGCGGCATCAGCGCCATCACCCTTCCCGCCGGCTACCTGGGCTCCTCAATCATCGGGGCCCTCCTCACC
TTCTGTGGCTTCAACATCGTCGCCTCCAAGATAGCCAGCATTGTCCTCGGCGTCTGCTTCCTTCTCACCCTATGG
TGGGGCAAGCGCGACTGGCTTACTATCCTCACCGTACTGAGTGCCGTCGGCCTTCTTGTGGCTTGCTGGTTCATC
GTCCATGCCGAGGCGCTCCGCTTTGTCGTCCTCTTTATCGGCGTCATGTCCTCTCTGTACAGCGTGTGGGACATT
TGCGACGACTTGATCCTCAGAAAGGTGAACTCGTCCGACGCCAGCGTCTTTGCCAAACGCTACGGCGGCTCTTCT
CAGTGCTGGGGCGTCATCTGGTCCATCATCTCGATTCTTGTCATGGCCGTCGGCATTGTCGCCGGCCTGGCTGCC
TTTTCTCAGTCTTTTGAGCAGCAGCAGCAGGACTCGCAACACTTCCTTCCCACCTAA
Transcript >Hirsu2|7598
ATGGCGCCTCGGGCCCTGCTGCCGAACGTCAGCTTCGACGAAAGCGACAGGCTCCATCTTCTCGCCGCCCGCGAC
CTTCAGAACCCGACGCGCACGCAGCAGATCACTTTGGGCGTCATCGCCGTGTACGTCGTTGCCATCGCCATCCTG
TGGAACGTCCCGTATCTCAAAATGATCCTCTGGCCCTTCAAGATGCTCGTCATCGCATTCCACGAATTCGGTCAT
GCCATTACCGCTGTCCTGACCGGCGGGAAAGTCAAGTCCATCAGCCTCGATCCCAACGAAGGCGGCGTCACTCAC
ATGCAGGGCGGCATCAGCGCCATCACCCTTCCCGCCGGCTACCTGGGCTCCTCAATCATCGGGGCCCTCCTCACC
TTCTGTGGCTTCAACATCGTCGCCTCCAAGATAGCCAGCATTGTCCTCGGCGTCTGCTTCCTTCTCACCCTATGG
TGGGGCAAGCGCGACTGGCTTACTATCCTCACCGTACTGAGTGCCGTCGGCCTTCTTGTGGCTTGCTGGTTCATC
GTCCATGCCGAGGCGCTCCGCTTTGTCGTCCTCTTTATCGGCGTCATGTCCTCTCTGTACAGCGTGTGGGACATT
TGCGACGACTTGATCCTCAGAAAGGTGAACTCGTCCGACGCCAGCGTCTTTGCCAAACGCTACGGCGGCTCTTCT
CAGTGCTGGGGCGTCATCTGGTCCATCATCTCGATTCTTGTCATGGCCGTCGGCATTGTCGCCGGCCTGGCTGCC
TTTTCTCAGTCTTTTGAGCAGCAGCAGCAGGACTCGCAACACTTCCTTCCCACCTAA
Gene >Hirsu2|7598
ATGGCGCCTCGGGCCCTGCTGCCGAACGTCAGCTTCGACGAAAGCGACAGGCTCCATCTTCTCGCCGCCCGCGAC
CTTCAGAACCCGACGCGCACGCAGCAGATCACTTTGGGCGTCATCGCCGTGTACGTCGTTGCCATCGCCATCCTG
TGGAACGTCCCGTATCTCAAAATGATCCTCTGGCCCTTCAAGGTGAGTTGGCTTCCGCCGGCCCGGCCGCCAAAT
CGTCGCCCTGCCGCTAATCTCCGGTGTTCCTCCAGATGCTCGTCATCGCATTCCACGAATTCGGTCATGCCATTA
CCGCTGTCCTGACCGGCGGGAAAGTCAAGTCCATCAGCCTCGATCCCAACGAAGGCGGCGTCACTCACATGCAGG
GCGGCATCAGCGCCATCACCCTTCCCGCCGGCTACCTGGGCTCCTCAATCATCGGGGCCCTCCTCACCTTCTGTG
GCTTCAACATCGTCGCCTCCAAGATAGCCAGCATTGTCCTCGGCGTCTGCTTCCTTCTCACCCTATGGTGGGGCA
AGCGCGACTGGCTTACTATCCTCACCGTACTGAGTGCCGTCGGCCTTCTTGTGGCTTGCTGGTTCATCGTCCATG
CCGAGGCGCTCCGCTTTGTCGTCCTCTTTATCGGCGTCATGTCCTCTCTGTACAGCGTGTGGGACATTTGCGACG
ACTTGATCCTCAGAAAGGTGAACTCGTCCGACGCCAGCGTCTTTGCCAAACGCTACGGCGGCTCTTCTCAGTGCT
GGGGCGTCATCTGGTCCATCATCTCGATTCTTGTCATGGCCGTCGGCATTGTCGCCGGCCTGGCTGCCTTTTCTC
AGTCTTTTGAGCAGCAGCAGCAGGACTCGCAACACTTCCTTCCCACCTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail