Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7588
Gene name
LocationContig_45:3324..4704
Strand+
Gene length (bp)1380
Transcript length (bp)1326
Coding sequence length (bp)1326
Protein length (aa) 442

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 9.7E-13 28 66
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.2E-08 29 66
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 3.8E-08 28 70
PF13445 zf-RING_UBOX RING-type zinc-finger 9.6E-08 29 64
PF14634 zf-RING_5 zinc-RING finger domain 5.5E-07 28 67

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WZJ6|RAD18_ASPFU Postreplication repair E3 ubiquitin-protein ligase rad18 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rad18 PE=3 SV=1 5 348 6.0E-105
sp|Q02398|RAD18_EMENI Postreplication repair E3 ubiquitin-protein ligase rad18 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uvsH PE=2 SV=1 5 339 9.0E-96
sp|P33288|RAD18_NEUCR Postreplication repair E3 ubiquitin-protein ligase rad18 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=uvs-2 PE=3 SV=2 5 351 2.0E-94
sp|O74747|RAD18_SCHPO Postreplication repair E3 ubiquitin-protein ligase rad18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp18 PE=3 SV=1 1 340 1.0E-47
sp|Q6CHI1|RAD18_YARLI Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAD18 PE=3 SV=1 5 342 6.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WZJ6|RAD18_ASPFU Postreplication repair E3 ubiquitin-protein ligase rad18 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rad18 PE=3 SV=1 5 348 6.0E-105
sp|Q02398|RAD18_EMENI Postreplication repair E3 ubiquitin-protein ligase rad18 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uvsH PE=2 SV=1 5 339 9.0E-96
sp|P33288|RAD18_NEUCR Postreplication repair E3 ubiquitin-protein ligase rad18 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=uvs-2 PE=3 SV=2 5 351 2.0E-94
sp|O74747|RAD18_SCHPO Postreplication repair E3 ubiquitin-protein ligase rad18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp18 PE=3 SV=1 1 340 1.0E-47
sp|Q6CHI1|RAD18_YARLI Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAD18 PE=3 SV=1 5 342 6.0E-42
sp|Q6BLM3|RAD18_DEBHA Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAD18 PE=3 SV=2 2 400 3.0E-37
sp|Q75EN0|RAD18_ASHGO Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAD18 PE=3 SV=1 6 343 7.0E-33
sp|Q6FPI4|RAD18_CANGA Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAD18 PE=3 SV=1 3 378 7.0E-29
sp|Q9QXK2|RAD18_MOUSE E3 ubiquitin-protein ligase RAD18 OS=Mus musculus GN=Rad18 PE=1 SV=2 17 357 8.0E-29
sp|Q5A4N5|RAD18_CANAL Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD18 PE=3 SV=1 1 338 4.0E-27
sp|Q9NS91|RAD18_HUMAN E3 ubiquitin-protein ligase RAD18 OS=Homo sapiens GN=RAD18 PE=1 SV=2 17 339 3.0E-26
sp|Q6CTZ8|RAD18_KLULA Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAD18 PE=3 SV=1 11 350 2.0E-22
sp|P10862|RAD18_YEAST Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD18 PE=1 SV=1 6 100 3.0E-17
sp|Q6AZZ1|TRI68_HUMAN E3 ubiquitin-protein ligase TRIM68 OS=Homo sapiens GN=TRIM68 PE=1 SV=1 16 117 4.0E-08
sp|Q03605|YNN1_CAEEL Uncharacterized RING finger protein T02C1.1 OS=Caenorhabditis elegans GN=T02C1.1 PE=3 SV=1 29 68 9.0E-08
sp|Q8K243|TRI68_MOUSE E3 ubiquitin-protein ligase TRIM68 OS=Mus musculus GN=Trim68 PE=2 SV=1 16 86 2.0E-07
sp|Q9D4H7|LONF3_MOUSE LON peptidase N-terminal domain and RING finger protein 3 OS=Mus musculus GN=Lonrf3 PE=2 SV=1 13 88 3.0E-07
sp|P10862|RAD18_YEAST Postreplication repair E3 ubiquitin-protein ligase RAD18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD18 PE=1 SV=1 200 344 4.0E-07
sp|Q12899|TRI26_HUMAN Tripartite motif-containing protein 26 OS=Homo sapiens GN=TRIM26 PE=1 SV=1 20 94 5.0E-07
sp|Q7YR34|TRI26_PANTR Tripartite motif-containing protein 26 OS=Pan troglodytes GN=TRIM26 PE=3 SV=1 20 94 5.0E-07
sp|Q99PN3|TRI26_MOUSE Tripartite motif-containing protein 26 OS=Mus musculus GN=Trim26 PE=2 SV=3 20 94 5.0E-07
sp|P62603|TRI26_RAT Tripartite motif-containing protein 26 OS=Rattus norvegicus GN=Trim26 PE=3 SV=1 20 94 6.0E-07
sp|Q8HXH0|LONF3_MACFA LON peptidase N-terminal domain and RING finger protein 3 OS=Macaca fascicularis GN=LONRF3 PE=2 SV=1 13 67 8.0E-07
sp|Q9C037|TRIM4_HUMAN E3 ubiquitin-protein ligase TRIM4 OS=Homo sapiens GN=TRIM4 PE=1 SV=2 23 92 8.0E-07
sp|Q496Y0|LONF3_HUMAN LON peptidase N-terminal domain and RING finger protein 3 OS=Homo sapiens GN=LONRF3 PE=1 SV=1 13 67 8.0E-07
sp|Q8RXD4|BRCA1_ARATH Protein BREAST CANCER SUSCEPTIBILITY 1 homolog OS=Arabidopsis thaliana GN=BRCA1 PE=1 SV=1 27 231 9.0E-07
sp|O77666|TRI26_PIG Tripartite motif-containing protein 26 OS=Sus scrofa GN=TRIM26 PE=3 SV=2 20 94 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7588
MTVDDVPDSTDWLSTPLSGLAAVEAALRCQVCKDFFKTPMITSCSHTFCSLCIRRALSSDGKCPLCRAPEQELKL
RSNWSIEDAVETFARARTDMLALARNRFAESTSQKRKVDVEESPEPQPKRLRASTRLSKARASTAAQLRDDVVEN
SDEDEDYVPDDPDGLVPCPACQTKMKAWRVFQHLETCPGPSPRRQANRRDENTAGEDSTAYTSGQVLRRQDKSLE
RLPALNYSMLKEQTLRKKMTELGISNQGPRQLLEKRHKEWLTLWNANCDAAHPKKRIGLLHDLEVWERTQGGRAP
TTGKAIQAAAAVRDKDFDAAAWAVKHDSSFKDLIAAARKSKLETKIRTGERGGGAALGQQTVMGAEAARVTHTSS
LLSPAECHDSTRSSVNLGKPIQPDPDAASQPGTPPDGSSNPTALIAKSPDDPRSSQPTLGAQDAIS*
Coding >Hirsu2|7588
ATGACCGTGGACGATGTTCCAGACTCGACAGACTGGCTCTCGACGCCACTGTCCGGCCTCGCTGCCGTTGAGGCG
GCCTTGCGCTGCCAGGTCTGCAAGGATTTCTTCAAAACTCCGATGATAACATCGTGCTCACACACATTCTGCTCC
CTGTGCATCCGGAGAGCACTATCCTCCGATGGAAAGTGCCCTCTCTGCCGAGCACCGGAGCAAGAGCTGAAATTA
CGAAGTAACTGGTCAATCGAGGACGCGGTGGAAACATTCGCCAGAGCACGAACAGACATGTTAGCCCTAGCCAGG
AACAGGTTCGCGGAGAGCACCTCTCAAAAGAGAAAAGTCGATGTTGAAGAGTCGCCCGAGCCACAACCGAAACGT
TTACGTGCTTCAACACGGCTTAGCAAGGCCCGCGCCTCCACGGCAGCCCAGCTACGAGACGACGTTGTGGAGAAC
TCAGATGAAGATGAGGACTACGTCCCAGATGACCCCGATGGCCTTGTCCCTTGCCCGGCTTGTCAGACGAAAATG
AAGGCATGGAGAGTGTTCCAGCATCTCGAAACATGTCCGGGTCCATCGCCTCGACGGCAAGCGAACAGAAGAGAT
GAAAATACAGCGGGAGAAGACAGTACCGCATATACTTCGGGTCAAGTTCTACGACGTCAAGATAAATCGCTCGAG
CGCCTACCAGCCCTAAATTATTCTATGCTCAAGGAGCAAACTCTGCGGAAGAAAATGACTGAACTTGGAATCTCC
AACCAAGGACCGCGGCAGTTGCTAGAAAAGCGCCACAAAGAGTGGTTAACCTTGTGGAATGCCAACTGTGATGCT
GCACATCCAAAGAAGCGTATTGGCCTCCTCCACGATCTAGAAGTCTGGGAACGGACACAGGGCGGCCGGGCGCCG
ACCACGGGCAAAGCCATCCAGGCTGCCGCGGCTGTCAGAGACAAGGATTTTGACGCCGCGGCCTGGGCTGTCAAG
CACGATTCTTCGTTCAAAGACTTGATTGCCGCGGCGAGGAAAAGCAAGTTGGAGACCAAGATAAGAACTGGCGAG
AGAGGTGGTGGGGCTGCTCTCGGGCAACAGACAGTAATGGGTGCAGAAGCTGCTCGAGTTACACATACCTCGAGC
TTGCTTTCTCCCGCAGAATGTCACGACAGTACGCGAAGCAGCGTTAACTTGGGGAAGCCAATACAGCCGGATCCG
GACGCTGCCAGTCAGCCGGGAACGCCGCCCGATGGCTCATCTAACCCGACGGCACTTATCGCAAAATCGCCTGAC
GATCCACGGTCCAGCCAGCCTACGCTGGGCGCCCAGGATGCTATAAGCTAG
Transcript >Hirsu2|7588
ATGACCGTGGACGATGTTCCAGACTCGACAGACTGGCTCTCGACGCCACTGTCCGGCCTCGCTGCCGTTGAGGCG
GCCTTGCGCTGCCAGGTCTGCAAGGATTTCTTCAAAACTCCGATGATAACATCGTGCTCACACACATTCTGCTCC
CTGTGCATCCGGAGAGCACTATCCTCCGATGGAAAGTGCCCTCTCTGCCGAGCACCGGAGCAAGAGCTGAAATTA
CGAAGTAACTGGTCAATCGAGGACGCGGTGGAAACATTCGCCAGAGCACGAACAGACATGTTAGCCCTAGCCAGG
AACAGGTTCGCGGAGAGCACCTCTCAAAAGAGAAAAGTCGATGTTGAAGAGTCGCCCGAGCCACAACCGAAACGT
TTACGTGCTTCAACACGGCTTAGCAAGGCCCGCGCCTCCACGGCAGCCCAGCTACGAGACGACGTTGTGGAGAAC
TCAGATGAAGATGAGGACTACGTCCCAGATGACCCCGATGGCCTTGTCCCTTGCCCGGCTTGTCAGACGAAAATG
AAGGCATGGAGAGTGTTCCAGCATCTCGAAACATGTCCGGGTCCATCGCCTCGACGGCAAGCGAACAGAAGAGAT
GAAAATACAGCGGGAGAAGACAGTACCGCATATACTTCGGGTCAAGTTCTACGACGTCAAGATAAATCGCTCGAG
CGCCTACCAGCCCTAAATTATTCTATGCTCAAGGAGCAAACTCTGCGGAAGAAAATGACTGAACTTGGAATCTCC
AACCAAGGACCGCGGCAGTTGCTAGAAAAGCGCCACAAAGAGTGGTTAACCTTGTGGAATGCCAACTGTGATGCT
GCACATCCAAAGAAGCGTATTGGCCTCCTCCACGATCTAGAAGTCTGGGAACGGACACAGGGCGGCCGGGCGCCG
ACCACGGGCAAAGCCATCCAGGCTGCCGCGGCTGTCAGAGACAAGGATTTTGACGCCGCGGCCTGGGCTGTCAAG
CACGATTCTTCGTTCAAAGACTTGATTGCCGCGGCGAGGAAAAGCAAGTTGGAGACCAAGATAAGAACTGGCGAG
AGAGGTGGTGGGGCTGCTCTCGGGCAACAGACAGTAATGGGTGCAGAAGCTGCTCGAGTTACACATACCTCGAGC
TTGCTTTCTCCCGCAGAATGTCACGACAGTACGCGAAGCAGCGTTAACTTGGGGAAGCCAATACAGCCGGATCCG
GACGCTGCCAGTCAGCCGGGAACGCCGCCCGATGGCTCATCTAACCCGACGGCACTTATCGCAAAATCGCCTGAC
GATCCACGGTCCAGCCAGCCTACGCTGGGCGCCCAGGATGCTATAAGCTAG
Gene >Hirsu2|7588
ATGACCGTGGACGATGTTCCAGACTCGACAGACTGGCTCTCGACGCCACTGTCCGGCCTCGCTGCCGTTGAGGCG
GCCTTGCGCTGCCAGGTCTGCAAGGATTTCTTCAAAACTCCGATGATAACATCGTGCTCACACACATTCTGCTCC
CTGTGCATCCGGAGAGCACTATCCTCCGATGGAAAGTGCCCTCTCTGCCGAGCACCGGAGCAAGAGCTGAAATTA
CGAAGTAACTGGTCAATCGAGGACGCGGTGGAAACATTCGCCAGAGCACGAACAGACATGTTAGCCCTAGCCAGG
AACAGGTTCGCGGAGAGCACCTCTCAAAAGAGAAAAGTCGATGTTGAAGAGTCGCCCGAGCCACAACCGAAACGT
TTACGTGCTTCAACACGGCTTAGCAAGGCCCGCGCCTCCACGGCAGCCCAGCTACGAGACGACGTTGTGGAGAAC
TCAGATGAAGATGAGGACTACGTCCCAGATGACCGCAAGTCGCGCACCTTCCCCCTTCTCGACTGTCTAAGCTAA
TAAGTCACCGCAGCCGATGGCCTTGTCCCTTGCCCGGCTTGTCAGACGAAAATGAAGGCATGGAGAGTGTTCCAG
CATCTCGAAACATGTCCGGGTCCATCGCCTCGACGGCAAGCGAACAGAAGAGATGAAAATACAGCGGGAGAAGAC
AGTACCGCATATACTTCGGGTCAAGTTCTACGACGTCAAGATAAATCGCTCGAGCGCCTACCAGCCCTAAATTAT
TCTATGCTCAAGGAGCAAACTCTGCGGAAGAAAATGACTGAACTTGGAATCTCCAACCAAGGACCGCGGCAGTTG
CTAGAAAAGCGCCACAAAGAGTGGTTAACCTTGTGGAATGCCAACTGTGATGCTGCACATCCAAAGAAGCGTATT
GGCCTCCTCCACGATCTAGAAGTCTGGGAACGGACACAGGGCGGCCGGGCGCCGACCACGGGCAAAGCCATCCAG
GCTGCCGCGGCTGTCAGAGACAAGGATTTTGACGCCGCGGCCTGGGCTGTCAAGCACGATTCTTCGTTCAAAGAC
TTGATTGCCGCGGCGAGGAAAAGCAAGTTGGAGACCAAGATAAGAACTGGCGAGAGAGGTGGTGGGGCTGCTCTC
GGGCAACAGACAGTAATGGGTGCAGAAGCTGCTCGAGTTACACATACCTCGAGCTTGCTTTCTCCCGCAGAATGT
CACGACAGTACGCGAAGCAGCGTTAACTTGGGGAAGCCAATACAGCCGGATCCGGACGCTGCCAGTCAGCCGGGA
ACGCCGCCCGATGGCTCATCTAACCCGACGGCACTTATCGCAAAATCGCCTGACGATCCACGGTCCAGCCAGCCT
ACGCTGGGCGCCCAGGATGCTATAAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail