Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7580
Gene name
LocationContig_449:5217..6184
Strand-
Gene length (bp)967
Transcript length (bp)894
Coding sequence length (bp)894
Protein length (aa) 298

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01014 Uricase Uricase 1.8E-41 8 131
PF01014 Uricase Uricase 6.0E-31 144 290

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33282|URIC_EMENI Uricase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uaZ PE=3 SV=1 1 295 3.0E-142
sp|Q00511|URIC_ASPFL Uricase OS=Aspergillus flavus GN=uaZ PE=1 SV=3 1 296 1.0E-140
sp|P78609|URIC_CYBJA Uricase OS=Cyberlindnera jadinii PE=3 SV=1 4 295 8.0E-85
sp|O74409|URIC_SCHPO Uricase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1223.09 PE=1 SV=1 3 295 9.0E-80
sp|P16163|URIC_DROME Uricase OS=Drosophila melanogaster GN=Uro PE=1 SV=2 2 295 6.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33282|URIC_EMENI Uricase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uaZ PE=3 SV=1 1 295 3.0E-142
sp|Q00511|URIC_ASPFL Uricase OS=Aspergillus flavus GN=uaZ PE=1 SV=3 1 296 1.0E-140
sp|P78609|URIC_CYBJA Uricase OS=Cyberlindnera jadinii PE=3 SV=1 4 295 8.0E-85
sp|O74409|URIC_SCHPO Uricase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1223.09 PE=1 SV=1 3 295 9.0E-80
sp|P16163|URIC_DROME Uricase OS=Drosophila melanogaster GN=Uro PE=1 SV=2 2 295 6.0E-52
sp|P22673|URIC_DROPS Uricase OS=Drosophila pseudoobscura pseudoobscura GN=Uro PE=2 SV=2 9 295 2.0E-51
sp|O04420|URIC_ARATH Uricase OS=Arabidopsis thaliana GN=At2g26230 PE=1 SV=2 8 295 6.0E-51
sp|D0VWQ1|URIC_ARTGO Uricase OS=Arthrobacter globiformis GN=uox PE=1 SV=1 8 295 2.0E-50
sp|P34798|URIC1_CANLI Uricase-2 isozyme 1 OS=Canavalia lineata PE=2 SV=1 8 295 2.0E-50
sp|O44111|URIC_DROSU Uricase (Fragment) OS=Drosophila subobscura GN=Uro PE=2 SV=1 9 295 2.0E-50
sp|P34799|URIC2_CANLI Uricase-2 isozyme 2 OS=Canavalia lineata PE=2 SV=1 8 295 1.0E-48
sp|P04670|URIC1_SOYBN Uricase-2 isozyme 1 OS=Glycine max PE=1 SV=2 8 295 5.0E-47
sp|O04104|URIC2_SOYBN Uricase-2 isozyme 2 OS=Glycine max PE=1 SV=1 8 295 2.0E-46
sp|P53763|URIC_PHAVU Uricase-2 OS=Phaseolus vulgaris GN=URIII PE=1 SV=2 8 295 3.0E-46
sp|P23194|URIC_DROVI Uricase OS=Drosophila virilis GN=Uro PE=2 SV=1 4 295 2.0E-45
sp|Q54LT2|URIC_DICDI Uricase OS=Dictyostelium discoideum GN=uox PE=3 SV=1 8 296 8.0E-43
sp|P11645|URIC_RABIT Uricase OS=Oryctolagus cuniculus GN=UOX PE=2 SV=1 9 295 4.0E-42
sp|Q5FZI9|URIC_CANLF Uricase OS=Canis lupus familiaris GN=UOX PE=1 SV=3 9 296 7.0E-41
sp|P09118|URIC_RAT Uricase OS=Rattus norvegicus GN=Uox PE=1 SV=3 9 296 5.0E-40
sp|P25688|URIC_MOUSE Uricase OS=Mus musculus GN=Uox PE=1 SV=2 9 296 8.0E-40
sp|P16164|URIC_PIG Uricase OS=Sus scrofa GN=UOX PE=2 SV=3 9 296 8.0E-40
sp|P25689|URIC_PAPHA Uricase OS=Papio hamadryas GN=UOX PE=2 SV=3 9 295 8.0E-40
sp|Q8MHW6|URIC_MACFA Uricase OS=Macaca fascicularis GN=UOX PE=3 SV=3 9 295 8.0E-40
sp|Q8MKJ2|URIC_AOTTR Uricase OS=Aotus trivirgatus GN=UOX PE=3 SV=3 9 295 1.0E-39
sp|Q3MHG7|URIC_BOVIN Uricase OS=Bos taurus GN=UOX PE=2 SV=3 9 296 3.0E-39
sp|Q8MKJ3|URIC_MACMU Uricase OS=Macaca mulatta GN=UOX PE=3 SV=3 9 295 5.0E-39
sp|D4GPU7|URIC_HALVD Uricase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=HVO_B0300 PE=3 SV=1 9 296 1.0E-23
sp|D8JBB7|URIC_HALJB Uricase OS=Halalkalicoccus jeotgali (strain DSM 18796 / CECT 7217 / JCM 14584 / KCTC 4019 / B3) GN=HacjB3_16061 PE=3 SV=2 9 296 2.0E-21
sp|Q45697|PUCL_BACSB Uric acid degradation bifunctional protein OS=Bacillus sp. (strain TB-90) GN=uao PE=1 SV=3 9 255 2.0E-17
sp|O32141|PUCL_BACSU Uric acid degradation bifunctional protein PucL OS=Bacillus subtilis (strain 168) GN=pucL PE=1 SV=1 9 295 6.0E-15
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Peroxisomal targeting signal 0.5053 0.6043 0.3668 0.0545 0.1125 0.0016 0.086 0.0466 0.01 0.379

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5603
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4503
Ophiocordyceps australis map64 (Brazil) OphauB2|3361
Ophiocordyceps camponoti-floridani Ophcf2|01750
Ophiocordyceps camponoti-rufipedis Ophun1|2216
Ophiocordyceps kimflemingae Ophio5|4950
Ophiocordyceps subramaniannii Hirsu2|7580 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7580
MPYISAARYGKDNVRILKVSRDADTGVQVVTELTVCCLLEGDIDSSYTRADNSVVVATDSIKNTAYIMAKQHAVD
PPEHFAAVLGSHFVQRYDHIHVAHVTVVAHRWLRMDVDGKPHPHSFVKDAGETRRAEARVGRRDGISLTSAIAGL
TLLKSTGSAFHGFVRDEFTTLPETWDRILSTDIDASWKWSTFADLAAVEENVERFDEAWLTARNTTLKLFAQDDS
ASVQNTMYKMCQQILDAVPGADSVAYSLPNKHNFELDMSWHNDLQNTGKDAEVYVPQICPNGLIKCEVSRSR*
Coding >Hirsu2|7580
ATGCCCTACATCTCGGCTGCCCGCTACGGCAAGGACAACGTCCGCATCCTCAAAGTCAGCCGCGATGCCGACACG
GGGGTGCAGGTCGTCACCGAGCTGACCGTCTGCTGCCTCCTCGAGGGCGACATCGACTCGTCTTACACACGGGCC
GACAACAGTGTCGTTGTCGCCACCGACTCCATTAAGAACACGGCTTACATCATGGCCAAACAGCACGCGGTCGAC
CCGCCTGAGCACTTCGCCGCCGTCCTCGGCAGCCACTTCGTCCAGAGGTACGACCACATCCATGTCGCCCACGTC
ACCGTCGTCGCCCACCGCTGGCTCCGGATGGACGTCGACGGCAAGCCGCATCCCCATAGCTTCGTCAAAGACGCC
GGCGAGACGCGCCGGGCCGAGGCCCGCGTCGGCCGGCGCGACGGCATTTCCCTCACCAGCGCCATCGCCGGCCTC
ACCCTCCTCAAGAGCACGGGCTCCGCCTTCCACGGCTTCGTCCGGGACGAGTTCACCACCCTGCCCGAGACCTGG
GACCGCATCTTGTCCACCGACATCGACGCCAGCTGGAAGTGGTCCACCTTTGCCGACCTCGCCGCCGTCGAGGAA
AACGTCGAACGCTTTGACGAGGCCTGGCTCACGGCCCGTAACACCACCCTCAAGCTATTTGCCCAGGACGACTCC
GCCAGCGTCCAGAACACCATGTACAAGATGTGCCAGCAGATCCTCGATGCCGTGCCCGGCGCCGACAGCGTCGCC
TACTCGCTGCCCAACAAGCACAACTTCGAGCTCGACATGAGTTGGCACAACGACCTACAAAACACGGGCAAGGAT
GCTGAGGTCTACGTCCCGCAAATCTGCCCCAACGGCCTCATCAAATGCGAAGTTTCACGCTCGCGATAG
Transcript >Hirsu2|7580
ATGCCCTACATCTCGGCTGCCCGCTACGGCAAGGACAACGTCCGCATCCTCAAAGTCAGCCGCGATGCCGACACG
GGGGTGCAGGTCGTCACCGAGCTGACCGTCTGCTGCCTCCTCGAGGGCGACATCGACTCGTCTTACACACGGGCC
GACAACAGTGTCGTTGTCGCCACCGACTCCATTAAGAACACGGCTTACATCATGGCCAAACAGCACGCGGTCGAC
CCGCCTGAGCACTTCGCCGCCGTCCTCGGCAGCCACTTCGTCCAGAGGTACGACCACATCCATGTCGCCCACGTC
ACCGTCGTCGCCCACCGCTGGCTCCGGATGGACGTCGACGGCAAGCCGCATCCCCATAGCTTCGTCAAAGACGCC
GGCGAGACGCGCCGGGCCGAGGCCCGCGTCGGCCGGCGCGACGGCATTTCCCTCACCAGCGCCATCGCCGGCCTC
ACCCTCCTCAAGAGCACGGGCTCCGCCTTCCACGGCTTCGTCCGGGACGAGTTCACCACCCTGCCCGAGACCTGG
GACCGCATCTTGTCCACCGACATCGACGCCAGCTGGAAGTGGTCCACCTTTGCCGACCTCGCCGCCGTCGAGGAA
AACGTCGAACGCTTTGACGAGGCCTGGCTCACGGCCCGTAACACCACCCTCAAGCTATTTGCCCAGGACGACTCC
GCCAGCGTCCAGAACACCATGTACAAGATGTGCCAGCAGATCCTCGATGCCGTGCCCGGCGCCGACAGCGTCGCC
TACTCGCTGCCCAACAAGCACAACTTCGAGCTCGACATGAGTTGGCACAACGACCTACAAAACACGGGCAAGGAT
GCTGAGGTCTACGTCCCGCAAATCTGCCCCAACGGCCTCATCAAATGCGAAGTTTCACGCTCGCGATAG
Gene >Hirsu2|7580
ATGCCCTACATCTCGGCTGCCCGCTACGGCAAGGACAACGTCCGCATCCTCAAAGTCAGCCGCGATGCCGACACG
GGGGTGCAGGTCGTCACCGAGCTGACCGTCTGCTGCCTCCTCGAGGGCGACATCGACTCGTCTTACACACGGGCC
GACAACAGTGTCGTTGTCGCCACCGACTCCATTAAGAACACGGCTTACATCATGGCCAAACAGCACGCGGTCGAC
CCGCCTGAGCACTTCGCCGCCGTCCTCGGCAGCCACTTCGTCCAGAGGTACGACCACATCCATGTCGCCCACGTC
ACCGTCGTCGCCCACCGCTGGCTCCGGATGGACGTCGACGGCAAGCCGCATCCCCATAGCTTCGTCAAAGACGCC
GGCGAGACGCGCCGGGCCGAGGCCCGCGTCGGCCGGCGCGACGGCATTTCCCTCACCAGCGCCATCGCCGGCCTC
ACCCTCCTCAAGAGCACGGGCTCCGCCTTCCACGGCTTCGTCCGGGACGAGTTCACCACCCTGCCCGAGACCTGG
GACCGCATCTTGTCCACCGACATCGACGCCAGCTGGAAGTGGTCCACCTTTGCCGACCTCGCCGCCGTCGAGGAA
AACGTCGAACGCTTTGACGAGGCCTGGCTCACGGCCCGTAACACCACCCTCAAGCTATTTGCCCAGGACGACTCC
GCCAGCGTCCAGAACACCATGTACAAGATGTGCCAGCAGATCCTCGATGCCGTGCCCGGCGCCGACAGCGTCGCC
TACTCGCTGCCCAACAAGCACAACTTCGAGCTCGGTCAGTCCTGCTGGTCCCCCTTACCTTGCCCCAGCATAGCC
AGAGCTTTGCTTACTTGTCAAATCTTTTCCAGACATGAGTTGGCACAACGACCTACAAAACACGGGCAAGGATGC
TGAGGTCTACGTCCCGCAAATCTGCCCCAACGGCCTCATCAAATGCGAAGTTTCACGCTCGCGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail