Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7575
Gene name
LocationContig_448:14443..16115
Strand+
Gene length (bp)1672
Transcript length (bp)1611
Coding sequence length (bp)1611
Protein length (aa) 537

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00448 SRP54 SRP54-type protein, GTPase domain 4.9E-77 101 296
PF02978 SRP_SPB Signal peptide binding domain 8.8E-32 326 426
PF02881 SRP54_N SRP54-type protein, helical bundle domain 9.8E-21 6 83
PF02492 cobW CobW/HypB/UreG, nucleotide-binding domain 1.2E-06 103 255

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00179|SRP54_ASPNG Signal recognition particle 54 kDa protein homolog OS=Aspergillus niger GN=srpA PE=3 SV=1 1 459 0.0E+00
sp|P21565|SRP54_SCHPO Signal recognition particle 54 kDa protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srp54 PE=1 SV=1 1 462 0.0E+00
sp|Q99150|SRP54_YARLI Signal recognition particle 54 kDa protein homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SRP54 PE=3 SV=2 1 443 0.0E+00
sp|P20424|SRP54_YEAST Signal recognition particle subunit SRP54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRP54 PE=1 SV=2 1 526 0.0E+00
sp|P14576|SRP54_MOUSE Signal recognition particle 54 kDa protein OS=Mus musculus GN=Srp54 PE=1 SV=2 1 503 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00179|SRP54_ASPNG Signal recognition particle 54 kDa protein homolog OS=Aspergillus niger GN=srpA PE=3 SV=1 1 459 0.0E+00
sp|P21565|SRP54_SCHPO Signal recognition particle 54 kDa protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srp54 PE=1 SV=1 1 462 0.0E+00
sp|Q99150|SRP54_YARLI Signal recognition particle 54 kDa protein homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SRP54 PE=3 SV=2 1 443 0.0E+00
sp|P20424|SRP54_YEAST Signal recognition particle subunit SRP54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRP54 PE=1 SV=2 1 526 0.0E+00
sp|P14576|SRP54_MOUSE Signal recognition particle 54 kDa protein OS=Mus musculus GN=Srp54 PE=1 SV=2 1 503 0.0E+00
sp|Q5R4R6|SRP54_PONAB Signal recognition particle 54 kDa protein OS=Pongo abelii GN=SRP54 PE=2 SV=1 1 503 0.0E+00
sp|Q4R965|SRP54_MACFA Signal recognition particle 54 kDa protein OS=Macaca fascicularis GN=SRP54 PE=2 SV=1 1 503 0.0E+00
sp|P61011|SRP54_HUMAN Signal recognition particle 54 kDa protein OS=Homo sapiens GN=SRP54 PE=1 SV=1 1 503 0.0E+00
sp|P61010|SRP54_CANLF Signal recognition particle 54 kDa protein OS=Canis lupus familiaris GN=SRP54 PE=1 SV=1 1 503 0.0E+00
sp|Q2T9U1|SRP54_BOVIN Signal recognition particle 54 kDa protein OS=Bos taurus GN=SRP54 PE=2 SV=1 1 503 0.0E+00
sp|Q6AYB5|SRP54_RAT Signal recognition particle 54 kDa protein OS=Rattus norvegicus GN=Srp54 PE=2 SV=1 1 503 0.0E+00
sp|O42816|SRP54_CANAX Signal recognition particle 54 kDa protein homolog OS=Candida albicans GN=SRP54 PE=2 SV=1 1 428 0.0E+00
sp|Q8MZJ6|SRP54_GEOCY Signal recognition particle 54 kDa protein OS=Geodia cydonium GN=SRP54 PE=2 SV=1 1 468 6.0E-177
sp|P49967|SR543_ARATH Signal recognition particle 54 kDa protein 3 OS=Arabidopsis thaliana GN=SRP-54C PE=2 SV=2 1 487 2.0E-155
sp|P49972|SR542_SOLLC Signal recognition particle 54 kDa protein 2 OS=Solanum lycopersicum PE=2 SV=1 1 479 2.0E-152
sp|P49969|SR542_HORVU Signal recognition particle 54 kDa protein 2 OS=Hordeum vulgare GN=SRP54-2 PE=2 SV=1 1 478 4.0E-152
sp|P49968|SR541_HORVU Signal recognition particle 54 kDa protein 1 OS=Hordeum vulgare GN=SRP54-1 PE=2 SV=1 1 478 1.0E-150
sp|P49971|SR541_SOLLC Signal recognition particle 54 kDa protein 1 OS=Solanum lycopersicum PE=3 SV=1 1 479 3.0E-148
sp|P37106|SR541_ARATH Signal recognition particle 54 kDa protein 1 OS=Arabidopsis thaliana GN=SRP-54A PE=2 SV=1 1 428 8.0E-145
sp|P49970|SR543_HORVU Signal recognition particle 54 kDa protein 3 OS=Hordeum vulgare GN=SRP54-3 PE=2 SV=1 1 497 1.0E-144
sp|Q75K18|SRP54_DICDI Signal recognition particle 54 kDa protein OS=Dictyostelium discoideum GN=srp54 PE=1 SV=1 1 501 3.0E-142
sp|P49966|SR542_ARATH Signal recognition particle 54 kDa protein 2 OS=Arabidopsis thaliana GN=SRP-54B PE=3 SV=2 1 499 2.0E-141
sp|O15821|SRP54_ENTHI Signal recognition particle 54 kDa protein OS=Entamoeba histolytica PE=3 SV=1 1 463 3.0E-140
sp|C5A233|SRP54_THEGJ Signal recognition particle 54 kDa protein OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=srp54 PE=3 SV=1 1 430 5.0E-119
sp|Q5JJC8|SRP54_THEKO Signal recognition particle 54 kDa protein OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=srp54 PE=3 SV=1 1 431 5.0E-117
sp|B6YSS1|SRP54_THEON Signal recognition particle 54 kDa protein OS=Thermococcus onnurineus (strain NA1) GN=srp54 PE=3 SV=1 1 430 7.0E-117
sp|Q8U070|SRP54_PYRFU Signal recognition particle 54 kDa protein OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=srp54 PE=1 SV=1 1 445 7.0E-114
sp|O59307|SRP54_PYRHO Signal recognition particle 54 kDa protein OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=srp54 PE=3 SV=3 1 445 4.0E-113
sp|Q9V1E8|SRP54_PYRAB Signal recognition particle 54 kDa protein OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=srp54 PE=3 SV=1 1 445 2.0E-112
sp|Q57565|SRP54_METJA Signal recognition particle 54 kDa protein OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=srp54 PE=1 SV=1 3 417 4.0E-105
sp|A6UWG4|SRP54_META3 Signal recognition particle 54 kDa protein OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=srp54 PE=3 SV=1 2 439 2.0E-104
sp|A2BNB5|SRP54_HYPBU Signal recognition particle 54 kDa protein OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=srp54 PE=3 SV=1 10 439 6.0E-102
sp|A0B638|SRP54_METTP Signal recognition particle 54 kDa protein OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=srp54 PE=3 SV=1 1 445 3.0E-101
sp|Q971S9|SRP54_SULTO Signal recognition particle 54 kDa protein OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=srp54 PE=3 SV=2 13 428 1.0E-100
sp|A6UQJ8|SRP54_METVS Signal recognition particle 54 kDa protein OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=srp54 PE=3 SV=1 2 439 3.0E-99
sp|Q2NE47|SRP54_METST Signal recognition particle 54 kDa protein OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=srp54 PE=3 SV=1 23 439 7.0E-98
sp|A9A9B0|SRP54_METM6 Signal recognition particle 54 kDa protein OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=srp54 PE=3 SV=1 2 439 2.0E-97
sp|A2STI3|SRP54_METLZ Signal recognition particle 54 kDa protein OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=srp54 PE=3 SV=1 1 439 5.0E-97
sp|Q12ZG8|SRP54_METBU Signal recognition particle 54 kDa protein OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=srp54 PE=3 SV=1 1 445 5.0E-97
sp|A6VHE0|SRP54_METM7 Signal recognition particle 54 kDa protein OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=srp54 PE=3 SV=1 2 439 5.0E-97
sp|Q0W2G1|SRP54_METAR Signal recognition particle 54 kDa protein OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=srp54 PE=3 SV=1 1 423 2.0E-96
sp|A4YHL0|SRP54_METS5 Signal recognition particle 54 kDa protein OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=srp54 PE=3 SV=1 25 446 2.0E-96
sp|C3NHT9|SRP54_SULIN Signal recognition particle 54 kDa protein OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=srp54 PE=3 SV=1 10 428 1.0E-95
sp|C3NDW4|SRP54_SULIY Signal recognition particle 54 kDa protein OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=srp54 PE=3 SV=1 25 428 1.0E-95
sp|C3MYM8|SRP54_SULIM Signal recognition particle 54 kDa protein OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=srp54 PE=3 SV=1 25 428 2.0E-95
sp|C4KGX6|SRP54_SULIK Signal recognition particle 54 kDa protein OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=srp54 PE=3 SV=1 25 428 2.0E-95
sp|C3N5B0|SRP54_SULIA Signal recognition particle 54 kDa protein OS=Sulfolobus islandicus (strain M.16.27) GN=srp54 PE=3 SV=1 25 428 2.0E-95
sp|C3MPN4|SRP54_SULIL Signal recognition particle 54 kDa protein OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=srp54 PE=3 SV=1 25 428 3.0E-95
sp|O07853|SRP54_SULAC Signal recognition particle 54 kDa protein OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=srp54 PE=3 SV=2 25 428 4.0E-95
sp|Q9YB62|SRP54_AERPE Signal recognition particle 54 kDa protein OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=srp54 PE=3 SV=1 10 439 5.0E-95
sp|P70722|SRP54_ACIAM Signal recognition particle 54 kDa protein (Fragment) OS=Acidianus ambivalens GN=srp54 PE=1 SV=2 25 446 5.0E-94
sp|Q46E01|SRP54_METBF Signal recognition particle 54 kDa protein OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=srp54 PE=3 SV=1 1 439 5.0E-94
sp|A5UMY7|SRP54_METS3 Signal recognition particle 54 kDa protein OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=srp54 PE=3 SV=2 2 436 2.0E-93
sp|O27376|SRP54_METTH Signal recognition particle 54 kDa protein OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=srp54 PE=3 SV=1 2 439 4.0E-93
sp|Q6LX03|SRP54_METMP Signal recognition particle 54 kDa protein OS=Methanococcus maripaludis (strain S2 / LL) GN=srp54 PE=3 SV=1 2 439 5.0E-93
sp|A3DML3|SRP54_STAMF Signal recognition particle 54 kDa protein OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=srp54 PE=3 SV=1 25 441 6.0E-93
sp|Q8THD0|SRP54_METAC Signal recognition particle 54 kDa protein OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=srp54 PE=3 SV=1 1 438 1.0E-92
sp|A4FVX4|SRP54_METM5 Signal recognition particle 54 kDa protein OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=srp54 PE=3 SV=1 2 439 3.0E-91
sp|O29633|SRP54_ARCFU Signal recognition particle 54 kDa protein OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=srp54 PE=1 SV=1 3 421 7.0E-90
sp|Q97ZE7|SRP54_SULSO Signal recognition particle 54 kDa protein OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=srp54 PE=1 SV=1 25 407 9.0E-90
sp|Q8PXF3|SRP54_METMA Signal recognition particle 54 kDa protein OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=srp54 PE=3 SV=1 1 438 1.0E-88
sp|Q18EV2|SRP54_HALWD Signal recognition particle 54 kDa protein OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=srp54 PE=3 SV=1 1 439 3.0E-88
sp|Q3IUP1|SRP54_NATPD Signal recognition particle 54 kDa protein OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=srp54 PE=3 SV=1 1 432 2.0E-87
sp|B9LT33|SRP54_HALLT Signal recognition particle 54 kDa protein OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=srp54 PE=3 SV=1 1 423 3.0E-87
sp|Q977V2|SRP54_HALVD Signal recognition particle 54 kDa protein OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=srp54 PE=1 SV=1 1 442 7.0E-87
sp|Q5UY20|SRP54_HALMA Signal recognition particle 54 kDa protein OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=srp54 PE=3 SV=1 1 432 1.0E-84
sp|Q9HKT0|SRP54_THEAC Signal recognition particle 54 kDa protein OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=srp54 PE=3 SV=1 1 441 3.0E-84
sp|A1RS43|SRP54_PYRIL Signal recognition particle 54 kDa protein OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=srp54 PE=3 SV=1 3 435 6.0E-83
sp|Q8TUY9|SRP54_METKA Signal recognition particle 54 kDa protein OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=srp54 PE=3 SV=1 23 439 2.0E-81
sp|B1Y9L4|SRP54_PYRNV Signal recognition particle 54 kDa protein OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=srp54 PE=3 SV=1 23 435 4.0E-80
sp|Q8ZT95|SRP54_PYRAE Signal recognition particle 54 kDa protein OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=srp54 PE=3 SV=1 23 430 6.0E-79
sp|A3MWX6|SRP54_PYRCJ Signal recognition particle 54 kDa protein OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=srp54 PE=3 SV=1 23 439 7.0E-79
sp|Q979Y8|SRP54_THEVO Signal recognition particle 54 kDa protein OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=srp54 PE=3 SV=1 1 448 2.0E-78
sp|A4WLQ3|SRP54_PYRAR Signal recognition particle 54 kDa protein OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=srp54 PE=3 SV=1 21 435 2.0E-77
sp|Q9HMN5|SRP54_HALSA Signal recognition particle 54 kDa protein OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=srp54 PE=3 SV=1 1 432 2.0E-77
sp|B0R7X3|SRP54_HALS3 Signal recognition particle 54 kDa protein OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=srp54 PE=3 SV=1 1 432 2.0E-77
sp|O67615|SRP54_AQUAE Signal recognition particle protein OS=Aquifex aeolicus (strain VF5) GN=ffh PE=3 SV=1 3 430 7.0E-69
sp|Q54431|SRP54_STRMU Signal recognition particle protein OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=ffh PE=3 SV=3 1 487 6.0E-66
sp|Q55311|SRP54_SYNE7 Signal recognition particle protein OS=Synechococcus elongatus (strain PCC 7942) GN=ffh PE=3 SV=1 6 412 4.0E-65
sp|P74214|SRP54_SYNY3 Signal recognition particle protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ffh PE=3 SV=1 6 418 4.0E-64
sp|O07347|SRP54_THEAQ Signal recognition particle protein OS=Thermus aquaticus GN=ffh PE=1 SV=3 2 439 2.0E-63
sp|P9WGD7|SRP54_MYCTU Signal recognition particle protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ffh PE=1 SV=1 3 431 6.0E-63
sp|P9WGD6|SRP54_MYCTO Signal recognition particle protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ffh PE=3 SV=1 3 431 6.0E-63
sp|P66845|SRP54_MYCBO Signal recognition particle protein OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ffh PE=3 SV=1 3 431 6.0E-63
sp|P37105|SRP54_BACSU Signal recognition particle protein OS=Bacillus subtilis (strain 168) GN=ffh PE=1 SV=1 1 442 2.0E-62
sp|O33013|SRP54_MYCLE Signal recognition particle protein OS=Mycobacterium leprae (strain TN) GN=ffh PE=3 SV=1 3 431 9.0E-62
sp|P37107|SR54C_ARATH Signal recognition particle 54 kDa protein, chloroplastic OS=Arabidopsis thaliana GN=FFC PE=1 SV=1 10 459 5.0E-61
sp|P44518|SRP54_HAEIN Signal recognition particle protein OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ffh PE=3 SV=1 3 428 5.0E-57
sp|Q1RHD6|SRP54_RICBR Signal recognition particle protein OS=Rickettsia bellii (strain RML369-C) GN=ffh PE=3 SV=1 23 440 5.0E-56
sp|Q92J55|SRP54_RICCN Signal recognition particle protein OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=ffh PE=3 SV=1 23 440 6.0E-56
sp|Q01442|SRP54_MYCMY Signal recognition particle protein OS=Mycoplasma mycoides GN=ffh PE=1 SV=1 6 418 7.0E-56
sp|P0AGD7|SRP54_ECOLI Signal recognition particle protein OS=Escherichia coli (strain K12) GN=ffh PE=1 SV=1 3 419 8.0E-56
sp|P0AGD8|SRP54_ECOL6 Signal recognition particle protein OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ffh PE=3 SV=1 3 419 8.0E-56
sp|P0AGD9|SRP54_ECO57 Signal recognition particle protein OS=Escherichia coli O157:H7 GN=ffh PE=3 SV=1 3 419 8.0E-56
sp|P56005|SRP54_HELPY Signal recognition particle protein OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ffh PE=3 SV=1 24 430 3.0E-54
sp|Q4UKH4|SRP54_RICFE Signal recognition particle protein OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=ffh PE=3 SV=2 23 439 4.0E-54
sp|Q9ZK62|SRP54_HELPJ Signal recognition particle protein OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ffh PE=3 SV=1 24 430 6.0E-54
sp|P75054|SRP54_MYCPN Signal recognition particle protein OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ffh PE=3 SV=1 1 435 1.0E-53
sp|P47294|SRP54_MYCGE Signal recognition particle protein OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=ffh PE=3 SV=1 1 435 4.0E-53
sp|Q89AE4|SRP54_BUCBP Signal recognition particle protein OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ffh PE=3 SV=1 3 419 4.0E-52
sp|Q9ZDZ0|SRP54_RICPR Signal recognition particle protein OS=Rickettsia prowazekii (strain Madrid E) GN=ffh PE=3 SV=1 23 440 8.0E-51
sp|Q68XJ4|SRP54_RICTY Signal recognition particle protein OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=ffh PE=3 SV=1 23 440 2.0E-47
sp|Q8K9F7|SRP54_BUCAP Signal recognition particle protein OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ffh PE=3 SV=1 3 417 1.0E-46
sp|P57473|SRP54_BUCAI Signal recognition particle protein OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ffh PE=3 SV=1 3 437 1.0E-44
sp|D4GYW6|FTSY_HALVD Signal recognition particle receptor FtsY OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=ftsY PE=3 SV=1 23 296 7.0E-40
sp|P57137|FTSY_BUCAI Signal recognition particle receptor FtsY OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ftsY PE=3 SV=1 23 295 4.0E-38
sp|O67066|FTSY_AQUAE Signal recognition particle receptor FtsY OS=Aquifex aeolicus (strain VF5) GN=ftsY PE=3 SV=1 103 295 6.0E-38
sp|P51835|FTSY_BACSU Signal recognition particle receptor FtsY OS=Bacillus subtilis (strain 168) GN=ftsY PE=1 SV=2 38 296 5.0E-36
sp|Q92GB8|FTSY_RICCN Signal recognition particle receptor FtsY OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=ftsY PE=3 SV=1 72 297 5.0E-36
sp|Q8TIN7|FTSY_METAC Signal recognition particle receptor FtsY OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=ftsY PE=3 SV=1 17 296 5.0E-36
sp|O30391|FTSY_NEIMC Signal recognition particle receptor FtsY OS=Neisseria meningitidis serogroup C GN=ftsY PE=3 SV=1 29 295 6.0E-36
sp|Q1RKK5|FTSY_RICBR Signal recognition particle receptor FtsY OS=Rickettsia bellii (strain RML369-C) GN=ftsY PE=3 SV=1 93 297 6.0E-36
sp|P57010|FTSY_NEIMA Signal recognition particle receptor FtsY OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=ftsY PE=3 SV=1 29 295 8.0E-36
sp|P57011|FTSY_NEIMB Signal recognition particle receptor FtsY OS=Neisseria meningitidis serogroup B (strain MC58) GN=ftsY PE=3 SV=1 29 295 9.0E-36
sp|D3UJA7|FTSY_HELM1 Signal recognition particle receptor FtsY OS=Helicobacter mustelae (strain ATCC 43772 / LMG 18044 / NCTC 12198 / 12198) GN=ftsY PE=3 SV=1 31 295 9.0E-36
sp|Q68VX4|FTSY_RICTY Signal recognition particle receptor FtsY OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=ftsY PE=3 SV=1 3 297 1.0E-35
sp|P14929|FTSY_NEIGO Signal recognition particle receptor FtsY OS=Neisseria gonorrhoeae GN=ftsY PE=1 SV=2 29 295 1.0E-35
sp|Q57739|FTSY_METJA Signal recognition particle receptor FtsY OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ftsY PE=3 SV=1 43 296 2.0E-35
sp|P44870|FTSY_HAEIN Signal recognition particle receptor FtsY OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ftsY PE=3 SV=1 42 295 3.0E-35
sp|Q8KA77|FTSY_BUCAP Signal recognition particle receptor FtsY OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ftsY PE=3 SV=1 23 295 4.0E-35
sp|Q726P7|FTSY_DESVH Signal recognition particle receptor FtsY OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=ftsY PE=3 SV=1 4 297 1.0E-34
sp|P27414|FTSY_SULAC Signal recognition particle receptor FtsY OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=ftsY PE=3 SV=1 16 296 2.0E-34
sp|O80842|CFTSY_ARATH Cell division protein FtsY homolog, chloroplastic OS=Arabidopsis thaliana GN=CPFTSY PE=1 SV=2 12 295 2.0E-34
sp|A9CHH2|FTSY_AGRFC Signal recognition particle receptor FtsY OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ftsY PE=3 SV=1 9 297 4.0E-34
sp|P83749|FTSY_THEAQ Signal recognition particle receptor FtsY OS=Thermus aquaticus GN=ftsY PE=1 SV=2 75 295 4.0E-34
sp|Q4UK46|FTSY_RICFE Signal recognition particle receptor FtsY OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=ftsY PE=3 SV=1 93 297 7.0E-34
sp|O05948|FTSY_RICPR Signal recognition particle receptor FtsY OS=Rickettsia prowazekii (strain Madrid E) GN=ftsY PE=3 SV=1 40 297 9.0E-34
sp|Q9HJ93|FTSY_THEAC Signal recognition particle receptor FtsY OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=ftsY PE=3 SV=1 100 295 3.0E-33
sp|Q8CWX8|FTSY_STRMU Signal recognition particle receptor FtsY OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=ftsY PE=3 SV=1 39 295 9.0E-33
sp|P10121|FTSY_ECOLI Signal recognition particle receptor FtsY OS=Escherichia coli (strain K12) GN=ftsY PE=1 SV=1 92 299 1.0E-32
sp|P73930|FTSY_SYNY3 Signal recognition particle receptor FtsY OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsY PE=3 SV=1 29 296 1.0E-32
sp|Q89B28|FTSY_BUCBP Signal recognition particle receptor FtsY OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ftsY PE=3 SV=1 27 296 1.0E-32
sp|O32861|FTSY_MYCHP Signal recognition particle receptor FtsY OS=Mycoplasma hominis (strain ATCC 23114 / NBRC 14850 / NCTC 10111 / PG21) GN=ftsY PE=3 SV=1 39 291 2.0E-31
sp|Q6MTB9|FTSY_MYCMS Signal recognition particle receptor FtsY OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=ftsY PE=1 SV=1 25 294 8.0E-31
sp|Q8G736|FTSY_BIFLO Signal recognition particle receptor FtsY OS=Bifidobacterium longum (strain NCC 2705) GN=ftsY PE=3 SV=1 7 296 1.0E-30
sp|P47539|FTSY_MYCGE Signal recognition particle receptor FtsY OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=ftsY PE=3 SV=1 73 291 1.0E-29
sp|Q9RS67|FTSY_DEIRA Signal recognition particle receptor FtsY OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=ftsY PE=3 SV=1 15 295 2.0E-29
sp|P75362|FTSY_MYCPN Signal recognition particle receptor FtsY OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ftsY PE=3 SV=1 69 291 6.0E-28
sp|P9WGD9|FTSY_MYCTU Signal recognition particle receptor FtsY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ftsY PE=1 SV=1 24 296 5.0E-27
sp|P9WGD8|FTSY_MYCTO Signal recognition particle receptor FtsY OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ftsY PE=3 SV=1 24 296 5.0E-27
sp|P66843|FTSY_MYCBO Signal recognition particle receptor FtsY OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ftsY PE=3 SV=1 24 296 5.0E-27
sp|O33010|FTSY_MYCLE Signal recognition particle receptor FtsY OS=Mycobacterium leprae (strain TN) GN=ftsY PE=3 SV=1 22 295 4.0E-26
sp|Q9Z6T7|FTSY_CHLPN Signal recognition particle receptor FtsY OS=Chlamydia pneumoniae GN=ftsY PE=3 SV=1 100 295 9.0E-26
sp|O25458|FTSY_HELPY Signal recognition particle receptor FtsY OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ftsY PE=3 SV=1 33 295 3.0E-25
sp|Q9ZL80|FTSY_HELPJ Signal recognition particle receptor FtsY OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ftsY PE=3 SV=1 14 295 2.0E-24
sp|O43032|SRPR_SCHPO Signal recognition particle receptor subunit alpha homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srp101 PE=3 SV=1 23 295 4.0E-24
sp|Q54ZR7|SRPR_DICDI Signal recognition particle receptor subunit alpha OS=Dictyostelium discoideum GN=srpr PE=3 SV=1 100 295 7.0E-21
sp|P08240|SRPR_HUMAN Signal recognition particle receptor subunit alpha OS=Homo sapiens GN=SRPR PE=1 SV=2 16 295 1.0E-20
sp|Q3MHE8|SRPR_BOVIN Signal recognition particle receptor subunit alpha OS=Bos taurus GN=SRPR PE=2 SV=1 16 295 1.0E-20
sp|Q9DBG7|SRPR_MOUSE Signal recognition particle receptor subunit alpha OS=Mus musculus GN=Srpr PE=1 SV=1 16 295 1.0E-20
sp|P06625|SRPR_CANLF Signal recognition particle receptor subunit alpha OS=Canis lupus familiaris GN=SRPR PE=2 SV=2 16 295 1.0E-19
sp|Q9U5L1|SRPR_DROME Signal recognition particle receptor subunit alpha homolog OS=Drosophila melanogaster GN=Gtp-bp PE=1 SV=2 39 295 2.0E-19
sp|P32916|SRPR_YEAST Signal recognition particle receptor subunit alpha homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRP101 PE=1 SV=2 98 296 1.0E-16
sp|Q56339|FLHF_TREPA Flagellar biosynthesis protein FlhF OS=Treponema pallidum (strain Nichols) GN=flhF PE=3 SV=1 104 301 6.0E-14
sp|O67266|FLHF_AQUAE Flagellar biosynthesis protein FlhF OS=Aquifex aeolicus (strain VF5) GN=flhF PE=3 SV=1 101 279 2.0E-10
sp|O52908|FLHF_CAMJE Flagellar biosynthesis protein FlhF OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=flhF PE=3 SV=2 103 291 6.0E-09
sp|O25679|FLHF_HELPY Flagellar biosynthesis protein FlhF OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=flhF PE=3 SV=1 103 295 2.0E-08
sp|Q9ZM34|FLHF_HELPJ Flagellar biosynthesis protein FlhF OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=flhF PE=3 SV=1 103 295 3.0E-08
sp|Q44758|FLHF_BORBU Flagellar biosynthesis protein FlhF OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=flhF PE=3 SV=1 100 309 4.0E-06
sp|Q01960|FLHF_BACSU Flagellar biosynthesis protein FlhF OS=Bacillus subtilis (strain 168) GN=flhF PE=1 SV=1 89 294 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008312 7S RNA binding Yes
GO:0005525 GTP binding Yes
GO:0006614 SRP-dependent cotranslational protein targeting to membrane Yes
GO:0048500 signal recognition particle Yes
GO:0003676 nucleic acid binding No
GO:0072599 establishment of protein localization to endoplasmic reticulum No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0051641 cellular localization No
GO:0032549 ribonucleoside binding No
GO:0006810 transport No
GO:0036094 small molecule binding No
GO:0006613 cotranslational protein targeting to membrane No
GO:0097159 organic cyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:1990904 ribonucleoprotein complex No
GO:0008104 protein localization No
GO:0008150 biological_process No
GO:0070972 protein localization to endoplasmic reticulum No
GO:0033036 macromolecule localization No
GO:0001883 purine nucleoside binding No
GO:0033365 protein localization to organelle No
GO:0045047 protein targeting to ER No
GO:0015833 peptide transport No
GO:0071705 nitrogen compound transport No
GO:0032550 purine ribonucleoside binding No
GO:0045184 establishment of protein localization No
GO:0003674 molecular_function No
GO:0006886 intracellular protein transport No
GO:0051649 establishment of localization in cell No
GO:0005575 cellular_component No
GO:0097367 carbohydrate derivative binding No
GO:0017076 purine nucleotide binding No
GO:0001882 nucleoside binding No
GO:1901363 heterocyclic compound binding No
GO:0071702 organic substance transport No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0034613 cellular protein localization No
GO:0070727 cellular macromolecule localization No
GO:0003723 RNA binding No
GO:0032991 protein-containing complex No
GO:0006612 protein targeting to membrane No
GO:0044424 intracellular part No
GO:0043168 anion binding No
GO:0051234 establishment of localization No
GO:0006605 protein targeting No
GO:0032561 guanyl ribonucleotide binding No
GO:0090150 establishment of protein localization to membrane No
GO:0042886 amide transport No
GO:0032555 purine ribonucleotide binding No
GO:0072594 establishment of protein localization to organelle No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0015031 protein transport No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0051179 localization No
GO:0046907 intracellular transport No
GO:0072657 protein localization to membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7575
MVLQDLGRRINAAVTNLTREQNLDEKAFDSMLKEICAALLEADVNVRLVGQLRKSIKSTVNFKELPPAVNKKRLI
QKAVFDELVKLVDPHADPFKPRKGRPNVIMFVGLQGAGKTTTCTKLARHYQTRGFRSCLVCADTFRAGAFDQLKQ
NATKAKIPYYGSLTETDPAAVARAGVEQFKKEKFDVIIVDTSGRHRQESALFQEMIDIQRAIRPDETIMVLDASI
GQQAESQAKAFKEAADFGAIIITKTDGHAHGGGAISAVAATRTPIVFIGTGEHMLDLERFAPQQFVQKLLGMGDM
AGLVEHVQSLNLNQKDTIKHIQEGIFTVRDLRDQLSNIMKMGPLSKMAGMIPGMSNMMQGMDDEEGGAKLKRMIY
ICDSMTDKELDSDGKILIEQPSRMTRIARGSGTSVREVEDLLTQQRMMAGMAKKMGGNMKNMQRAQQAMGGGNKA
QQLAAMQKRLQSMGGGAGGGAGGMPDMGSLMRMLGGGGGAGGGMPGGMDLSAMMRQMGMGGGMPGMPGMPGMPGM
PGAGSRGRGRR*
Coding >Hirsu2|7575
ATGGTCCTTCAAGATCTCGGCCGCCGCATCAATGCGGCGGTCACCAACCTGACGAGGGAGCAGAACCTCGACGAG
AAGGCCTTCGACTCGATGCTGAAGGAAATCTGTGCCGCCCTCCTCGAAGCCGACGTCAACGTGCGACTGGTCGGA
CAGCTGCGCAAGTCGATCAAGAGCACCGTCAACTTCAAGGAGCTGCCTCCCGCCGTCAACAAGAAGCGGCTCATC
CAAAAAGCCGTCTTCGATGAGCTCGTTAAGCTGGTCGACCCGCACGCCGACCCATTCAAGCCCAGAAAGGGCAGG
CCCAACGTCATCATGTTTGTCGGCCTGCAGGGTGCCGGCAAGACGACGACGTGCACCAAGCTTGCCCGGCATTAC
CAGACAAGGGGCTTCCGCTCGTGCCTGGTGTGCGCCGATACCTTCCGTGCCGGCGCCTTCGACCAGCTCAAGCAG
AACGCGACCAAGGCCAAGATCCCCTACTACGGCTCCCTCACCGAGACGGACCCGGCCGCCGTGGCTCGCGCGGGC
GTCGAGCAGTTCAAGAAGGAAAAGTTCGACGTCATCATCGTCGATACGTCGGGCCGGCACCGACAGGAATCGGCC
CTGTTCCAAGAGATGATTGACATCCAGCGGGCGATCCGGCCCGACGAGACCATTATGGTGCTCGACGCGTCCATC
GGCCAACAGGCCGAGTCGCAGGCCAAGGCGTTCAAGGAGGCGGCCGACTTCGGGGCCATCATCATCACCAAGACG
GACGGCCACGCACACGGAGGCGGCGCCATCTCGGCCGTGGCCGCAACGCGCACGCCCATCGTCTTCATCGGCACT
GGCGAGCACATGCTGGATCTGGAGCGGTTTGCGCCGCAGCAGTTTGTGCAGAAGCTACTGGGCATGGGGGATATG
GCAGGCTTGGTGGAGCATGTGCAGAGCCTCAATCTGAACCAAAAGGACACCATCAAGCACATCCAAGAAGGCATC
TTTACGGTTCGCGACCTGCGGGACCAGCTGTCCAACATCATGAAGATGGGCCCGCTGTCCAAGATGGCGGGCATG
ATACCCGGCATGAGCAACATGATGCAGGGCATGGACGACGAGGAGGGCGGGGCGAAGCTCAAGCGCATGATCTAC
ATATGCGACTCGATGACGGACAAGGAGCTTGACTCGGACGGCAAGATACTAATCGAGCAGCCGAGTCGGATGACG
AGGATAGCTCGGGGCTCCGGCACGTCGGTCCGCGAGGTCGAGGACCTGCTGACGCAGCAGCGGATGATGGCCGGC
ATGGCCAAGAAGATGGGCGGCAACATGAAGAACATGCAGAGGGCCCAACAAGCCATGGGCGGCGGAAACAAAGCC
CAACAGCTCGCAGCCATGCAGAAGCGGCTGCAGAGCATGGGCGGCGGCGCCGGCGGCGGCGCGGGTGGGATGCCG
GATATGGGGTCGCTAATGAGGATGCTGGGCGGCGGCGGGGGGGCCGGAGGAGGGATGCCGGGGGGGATGGACCTG
TCGGCCATGATGCGGCAGATGGGCATGGGCGGCGGGATGCCCGGGATGCCCGGGATGCCTGGGATGCCCGGGATG
CCCGGGGCCGGGAGTCGGGGCCGGGGGCGGCGGTGA
Transcript >Hirsu2|7575
ATGGTCCTTCAAGATCTCGGCCGCCGCATCAATGCGGCGGTCACCAACCTGACGAGGGAGCAGAACCTCGACGAG
AAGGCCTTCGACTCGATGCTGAAGGAAATCTGTGCCGCCCTCCTCGAAGCCGACGTCAACGTGCGACTGGTCGGA
CAGCTGCGCAAGTCGATCAAGAGCACCGTCAACTTCAAGGAGCTGCCTCCCGCCGTCAACAAGAAGCGGCTCATC
CAAAAAGCCGTCTTCGATGAGCTCGTTAAGCTGGTCGACCCGCACGCCGACCCATTCAAGCCCAGAAAGGGCAGG
CCCAACGTCATCATGTTTGTCGGCCTGCAGGGTGCCGGCAAGACGACGACGTGCACCAAGCTTGCCCGGCATTAC
CAGACAAGGGGCTTCCGCTCGTGCCTGGTGTGCGCCGATACCTTCCGTGCCGGCGCCTTCGACCAGCTCAAGCAG
AACGCGACCAAGGCCAAGATCCCCTACTACGGCTCCCTCACCGAGACGGACCCGGCCGCCGTGGCTCGCGCGGGC
GTCGAGCAGTTCAAGAAGGAAAAGTTCGACGTCATCATCGTCGATACGTCGGGCCGGCACCGACAGGAATCGGCC
CTGTTCCAAGAGATGATTGACATCCAGCGGGCGATCCGGCCCGACGAGACCATTATGGTGCTCGACGCGTCCATC
GGCCAACAGGCCGAGTCGCAGGCCAAGGCGTTCAAGGAGGCGGCCGACTTCGGGGCCATCATCATCACCAAGACG
GACGGCCACGCACACGGAGGCGGCGCCATCTCGGCCGTGGCCGCAACGCGCACGCCCATCGTCTTCATCGGCACT
GGCGAGCACATGCTGGATCTGGAGCGGTTTGCGCCGCAGCAGTTTGTGCAGAAGCTACTGGGCATGGGGGATATG
GCAGGCTTGGTGGAGCATGTGCAGAGCCTCAATCTGAACCAAAAGGACACCATCAAGCACATCCAAGAAGGCATC
TTTACGGTTCGCGACCTGCGGGACCAGCTGTCCAACATCATGAAGATGGGCCCGCTGTCCAAGATGGCGGGCATG
ATACCCGGCATGAGCAACATGATGCAGGGCATGGACGACGAGGAGGGCGGGGCGAAGCTCAAGCGCATGATCTAC
ATATGCGACTCGATGACGGACAAGGAGCTTGACTCGGACGGCAAGATACTAATCGAGCAGCCGAGTCGGATGACG
AGGATAGCTCGGGGCTCCGGCACGTCGGTCCGCGAGGTCGAGGACCTGCTGACGCAGCAGCGGATGATGGCCGGC
ATGGCCAAGAAGATGGGCGGCAACATGAAGAACATGCAGAGGGCCCAACAAGCCATGGGCGGCGGAAACAAAGCC
CAACAGCTCGCAGCCATGCAGAAGCGGCTGCAGAGCATGGGCGGCGGCGCCGGCGGCGGCGCGGGTGGGATGCCG
GATATGGGGTCGCTAATGAGGATGCTGGGCGGCGGCGGGGGGGCCGGAGGAGGGATGCCGGGGGGGATGGACCTG
TCGGCCATGATGCGGCAGATGGGCATGGGCGGCGGGATGCCCGGGATGCCCGGGATGCCTGGGATGCCCGGGATG
CCCGGGGCCGGGAGTCGGGGCCGGGGGCGGCGGTGA
Gene >Hirsu2|7575
ATGGTCCTTCAAGATCTCGGCCGCCGCATCAATGCGGCGGTCACCAACCTGACGAGGGAGCAGAACCTCGACGAG
AAGGTAATCGAACGAAGCGGAGGCTGCTGCTTTTGAGCCGAGACTGACGCACAGCGCCTTACAGGCCTTCGACTC
GATGCTGAAGGAAATCTGTGCCGCCCTCCTCGAAGCCGACGTCAACGTGCGACTGGTCGGACAGCTGCGCAAGTC
GATCAAGAGCACCGTCAACTTCAAGGAGCTGCCTCCCGCCGTCAACAAGAAGCGGCTCATCCAAAAAGCCGTCTT
CGATGAGCTCGTTAAGCTGGTCGACCCGCACGCCGACCCATTCAAGCCCAGAAAGGGCAGGCCCAACGTCATCAT
GTTTGTCGGCCTGCAGGGTGCCGGCAAGACGACGACGTGCACCAAGCTTGCCCGGCATTACCAGACAAGGGGCTT
CCGCTCGTGCCTGGTGTGCGCCGATACCTTCCGTGCCGGCGCCTTCGACCAGCTCAAGCAGAACGCGACCAAGGC
CAAGATCCCCTACTACGGCTCCCTCACCGAGACGGACCCGGCCGCCGTGGCTCGCGCGGGCGTCGAGCAGTTCAA
GAAGGAAAAGTTCGACGTCATCATCGTCGATACGTCGGGCCGGCACCGACAGGAATCGGCCCTGTTCCAAGAGAT
GATTGACATCCAGCGGGCGATCCGGCCCGACGAGACCATTATGGTGCTCGACGCGTCCATCGGCCAACAGGCCGA
GTCGCAGGCCAAGGCGTTCAAGGAGGCGGCCGACTTCGGGGCCATCATCATCACCAAGACGGACGGCCACGCACA
CGGAGGCGGCGCCATCTCGGCCGTGGCCGCAACGCGCACGCCCATCGTCTTCATCGGCACTGGCGAGCACATGCT
GGATCTGGAGCGGTTTGCGCCGCAGCAGTTTGTGCAGAAGCTACTGGGCATGGGGGATATGGCAGGCTTGGTGGA
GCATGTGCAGAGCCTCAATCTGAACCAAAAGGACACCATCAAGCACATCCAAGAAGGCATCTTTACGGTTCGCGA
CCTGCGGGACCAGCTGTCCAACATCATGAAGATGGGCCCGCTGTCCAAGATGGCGGGCATGATACCCGGCATGAG
CAACATGATGCAGGGCATGGACGACGAGGAGGGCGGGGCGAAGCTCAAGCGCATGATCTACATATGCGACTCGAT
GACGGACAAGGAGCTTGACTCGGACGGCAAGATACTAATCGAGCAGCCGAGTCGGATGACGAGGATAGCTCGGGG
CTCCGGCACGTCGGTCCGCGAGGTCGAGGACCTGCTGACGCAGCAGCGGATGATGGCCGGCATGGCCAAGAAGAT
GGGCGGCAACATGAAGAACATGCAGAGGGCCCAACAAGCCATGGGCGGCGGAAACAAAGCCCAACAGCTCGCAGC
CATGCAGAAGCGGCTGCAGAGCATGGGCGGCGGCGCCGGCGGCGGCGCGGGTGGGATGCCGGATATGGGGTCGCT
AATGAGGATGCTGGGCGGCGGCGGGGGGGCCGGAGGAGGGATGCCGGGGGGGATGGACCTGTCGGCCATGATGCG
GCAGATGGGCATGGGCGGCGGGATGCCCGGGATGCCCGGGATGCCTGGGATGCCCGGGATGCCCGGGGCCGGGAG
TCGGGGCCGGGGGCGGCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail